Tel:
+49 (0)241 95 163 153
Fax:
+49 (0)241 95 163 155
E-Mail:
orders@anticorps-enligne.fr

PDPK1 anticorps (C-Term)

PDPK1 Reactivité: Humain, Souris, Rat WB, IHC (p) Hôte: Lapin Polyclonal unconjugated
N° du produit ABIN3043600
  • Antigène Voir toutes PDPK1 Anticorps
    PDPK1 (3-phosphoinositide Dependent Protein Kinase-1 (PDPK1))
    Épitope
    • 21
    • 18
    • 16
    • 15
    • 15
    • 15
    • 8
    • 7
    • 6
    • 6
    • 4
    • 4
    • 3
    • 3
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    AA 524-556, C-Term
    Reactivité
    • 163
    • 115
    • 79
    • 11
    • 5
    • 4
    • 4
    • 4
    • 3
    • 2
    • 2
    • 1
    • 1
    • 1
    Humain, Souris, Rat
    Hôte
    • 158
    • 21
    • 1
    Lapin
    Clonalité
    • 151
    • 29
    Polyclonal
    Conjugué
    • 81
    • 10
    • 9
    • 7
    • 5
    • 5
    • 5
    • 5
    • 5
    • 5
    • 5
    • 5
    • 5
    • 5
    • 5
    • 3
    • 3
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    Cet anticorp PDPK1 est non-conjugé
    Application
    • 139
    • 67
    • 53
    • 53
    • 27
    • 26
    • 12
    • 10
    • 8
    • 7
    • 7
    • 5
    • 3
    • 2
    • 1
    • 1
    Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
    Fonction
    Rabbit IgG polyclonal antibody for 3-phosphoinositide-dependent protein kinase 1(PDPK1) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
    Séquence
    YLMDPSGNAH KWCRKIQEVW RQRYQSHPDA AVQ
    Réactivité croisée (Details)
    No cross reactivity with other proteins.
    Attributs du produit
    Rabbit IgG polyclonal antibody for 3-phosphoinositide-dependent protein kinase 1(PDPK1) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
    Gene Name: 3-phosphoinositide dependent protein kinase 1
    Protein Name: 3-phosphoinositide-dependent protein kinase 1
    Purification
    Immunogen affinity purified.
    Immunogène
    A synthetic peptide corresponding to a sequence at the C-terminus of human PDPK1 (524-556aa YLMDPSGNAHKWCRKIQEVWRQRYQSHPDAAVQ), different from the related mouse and rat sequences by two amino acids.
    Isotype
    IgG
    Top Product
    Discover our top product PDPK1 Anticorps primaire
  • Indications d'application
    WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
    IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Mouse, Rat, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
    Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.
    Commentaires

    Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

    Restrictions
    For Research Use only
  • Format
    Lyophilized
    Reconstitution
    Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
    Concentration
    500 μg/mL
    Buffer
    Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
    Agent conservateur
    Sodium azide
    Précaution d'utilisation
    This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
    Conseil sur la manipulation
    Avoid repeated freezing and thawing.
    Stock
    4 °C/-20 °C
    Stockage commentaire
    At -20°C for one year. After reconstitution, at 4°C for one month.
    It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
  • Antigène
    PDPK1 (3-phosphoinositide Dependent Protein Kinase-1 (PDPK1))
    Autre désignation
    PDPK1 (PDPK1 Produits)
    Synonymes
    anticorps pdpk1, anticorps MGC82080, anticorps PDK1, anticorps PDPK2, anticorps PRO0461, anticorps Pdk1, anticorps zgc:153787, anticorps 3'-phosphoinositide-dependent protein kinase 1, anticorps 3-PHOSPHOINOSITIDE-DEPENDENT PROTEIN KINASE 1, anticorps ATPDK1, anticorps AtPDK1, anticorps T32M21.110, anticorps T32M21_110, anticorps zgc:77318, anticorps 3-phosphoinositide dependent protein kinase 1, anticorps 3-phosphoinositide dependent protein kinase 1 L homeolog, anticorps 3-phosphoinositide dependent protein kinase-1, anticorps 3-phosphoinositide dependent protein kinase 1a, anticorps 3-phosphoinositide-dependent protein kinase 1, anticorps 3'-phosphoinositide-dependent protein kinase 1, anticorps 3-phosphoinositide dependent protein kinase 1b, anticorps PDPK1, anticorps pdpk1.L, anticorps pdpk1, anticorps Pdpk1, anticorps pdpk1a, anticorps LOC100380750, anticorps pdk-1, anticorps PDK1, anticorps pdpk1b
    Sujet
    3-phosphoinositide dependent protein kinase-1, also known as PDPK1, is a protein which in humans is encoded by the PDPK1 gene. It is mapped to 16p13.3. PDPK1 is a master kinase, which is crucial for the activation of AKT/PKB and many other AGC kinases including PKC, S6K, SGK. An important role for PDPK1 is in the signalling pathways activated by several growth factors and hormones including insulin signaling. Mice lacking PDPK1 die during early embryonic development, indicating that this enzyme is critical for transmitting the growth-promoting signals necessary for normal mammalian development.

    Synonyms: 3 phosphoinositide dependent protein kinase 1 antibody|3-phosphoinositide-dependent protein kinase 1 antibody|hPDK 1 antibody|hPDK1 antibody|MGC20087 antibody|MGC35290 antibody|OTTHUMP00000159109 antibody|OTTHUMP00000159110 antibody|OTTHUMP00000174525 antibody| PDK1 antibody|Pdpk1 antibody|PDPK1_HUMAN antibody|PDPK2 antibody|PkB kinase antibody|PkB kinase like gene 1 antibody|PkB like 1 antibody|PRO0461 antibody|Protein kinase antibody
    ID gène
    5170
    UniProt
    O15530
    Pathways
    Signalisation PI3K-Akt, TCR Signaling, Fc-epsilon Receptor Signaling Pathway, EGFR Signaling Pathway, Neurotrophin Signaling Pathway, Regulation of Leukocyte Mediated Immunity, Positive Regulation of Immune Effector Process, Cell-Cell Junction Organization, Regulation of Cell Size, Skeletal Muscle Fiber Development, CXCR4-mediated Signaling Events, Signaling Events mediated by VEGFR1 and VEGFR2, VEGFR1 Specific Signals
Vous êtes ici:
Support technique