BMP5 anticorps (C-Term)

N° du produit ABIN3043800

Détail du produit anti-BMP5 anticorps

Antigène: BMP5 (Bone Morphogenetic Protein 5 (BMP5))

Épitope: AA 332-365, C-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp BMP5 est non-conjugé

Application: Western Blotting (WB), ELISA, Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Fonction: Rabbit IgG polyclonal antibody for Bone morphogenetic protein 5(BMP5) detection. Tested with WB, IHC-P, ELISA in Human,Mouse,Rat.

Séquence: HQDSSRMSSV GDYNTSEQKQ ACKKHELYVS FRDL

Réactivité croisée (Details): No cross reactivity with other proteins.

Attributs du produit: Rabbit IgG polyclonal antibody for Bone morphogenetic protein 5(BMP5) detection. Tested with WB, IHC-P, ELISA in Human,Mouse,Rat.
Gene Name: bone morphogenetic protein 5
Protein Name: Bone morphogenetic protein 5

Purification: Immunogen affinity purified.

Immunogène: A synthetic peptide corresponding to a sequence at the C-terminus of human BMP-5 (332-365aa HQDSSRMSSVGDYNTSEQKQACKKHELYVSFRDL), different from the related mouse sequence by three amino acids.

Isotype: IgG

Information d'application

Indications d'application: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Mouse, Rat, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
ELISA: Concentration: 0.1-0.5 μg/mL, Tested Species: Human

Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Commentaires:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Conseil sur la manipulation: Avoid repeated freezing and thawing.

Stock: 4 °C/-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Références pour anticorps anti-BMP5 (ABIN3043800)

Wang, Xue, Zhao, Liu, Ma, Ma: "Form-deprivation myopia induces decreased expression of bone morphogenetic protein-2, 5 in guinea pig sclera." dans: International journal of ophthalmology, Vol. 8, Issue 1, pp. 39-45, (2015) (PubMed).

Détails sur BMP5

Antigène: BMP5 (Bone Morphogenetic Protein 5 (BMP5))

Autre désignation: BMP5 (BMP5 Produits)

Synonymes: anticorps bmp5l, anticorps hm:zehl0669, anticorps zehl0669, anticorps zgc:64230, anticorps BMP5, anticorps AU023399, anticorps se, anticorps bone morphogenetic protein 5, anticorps bmp5, anticorps BMP5, anticorps LOC100539495, anticorps Bmp5

Sujet: Bone morphogenetic protein 5 is a protein that in humans is encoded by the BMP5 gene. This gene encodes a member of the bone morphogenetic protein family which is part of the transforming growth factor-beta superfamily. The superfamily includes large families of growth and differentiation factors. Bone morphogenetic proteins were originally identified by an ability of demineralized bone extract to induce endochondral osteogenesis in vivo in an extraskeletal site. These proteins are synthesized as prepropeptides, cleaved, and then processed into dimeric proteins. And this protein may act as an important signaling molecule within the trabecular meshwork and optic nerve head, and may play a potential role in glaucoma pathogenesis. This gene is differentially regulated during the formation of various tumors.

Synonyms: BMP 5 antibody|BMP-5 antibody|Bmp5 antibody|BMP5_HUMAN antibody|Bone morphogenetic protein 5 antibody|MGC34244 antibody

ID gène: 653

UniProt: P22003

Pathways: Regulation of Hormone Metabolic Process, Regulation of Hormone Biosynthetic Process