Tel:
+49 (0)241 95 163 153
Fax:
+49 (0)241 95 163 155
E-Mail:
orders@anticorps-enligne.fr

EWSR1 anticorps (Middle Region)

EWSR1 Reactivité: Humain, Souris, Rat WB, IHC (p) Hôte: Lapin Polyclonal unconjugated
N° du produit ABIN3043825
  • Antigène Voir toutes EWSR1 Anticorps
    EWSR1 (Ewing Sarcoma Breakpoint Region 1 (EWSR1))
    Épitope
    • 13
    • 8
    • 7
    • 5
    • 3
    • 3
    • 2
    • 2
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    AA 369-399, Middle Region
    Reactivité
    • 73
    • 33
    • 26
    • 10
    • 8
    • 8
    • 7
    • 7
    • 5
    • 5
    • 4
    • 3
    • 2
    Humain, Souris, Rat
    Hôte
    • 61
    • 10
    • 2
    • 1
    Lapin
    Clonalité
    • 64
    • 10
    Polyclonal
    Conjugué
    • 51
    • 5
    • 3
    • 3
    • 3
    • 3
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    Cet anticorp EWSR1 est non-conjugé
    Application
    • 65
    • 32
    • 14
    • 13
    • 6
    • 5
    • 4
    • 3
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
    Fonction
    Rabbit IgG polyclonal antibody for RNA-binding protein EWS(EWSR1) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
    Séquence
    NDSVTLDDLA DFFKQCGVVK MNKRTGQPMI H
    Réactivité croisée (Details)
    No cross reactivity with other proteins.
    Attributs du produit
    Rabbit IgG polyclonal antibody for RNA-binding protein EWS(EWSR1) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
    Gene Name: EWS RNA-binding protein 1
    Protein Name: RNA-binding protein EWS
    Purification
    Immunogen affinity purified.
    Immunogène
    A synthetic peptide corresponding to a sequence in the middle region of human EWSR1 (369-399aa NDSVTLDDLADFFKQCGVVKMNKRTGQPMIH), different from the related mouse sequence by one amino acid.
    Isotype
    IgG
    Top Product
    Discover our top product EWSR1 Anticorps primaire
  • Indications d'application
    WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Rat
    IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Mouse, Rat, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
    Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.
    Commentaires

    Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

    Restrictions
    For Research Use only
  • Format
    Lyophilized
    Reconstitution
    Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
    Concentration
    500 μg/mL
    Buffer
    Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
    Agent conservateur
    Sodium azide
    Précaution d'utilisation
    This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
    Conseil sur la manipulation
    Avoid repeated freezing and thawing.
    Stock
    4 °C/-20 °C
    Stockage commentaire
    At -20°C for one year. After reconstitution, at 4°C for one month.
    It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
  • Antigène
    EWSR1 (Ewing Sarcoma Breakpoint Region 1 (EWSR1))
    Autre désignation
    EWSR1 (EWSR1 Produits)
    Synonymes
    anticorps EWS, anticorps bK984G1.4, anticorps AU018891, anticorps Ews, anticorps Ewsh, anticorps EWSR1, anticorps fc04c01, anticorps wu:fc04c01, anticorps DKFZp459K1116, anticorps ewsr1, anticorps ewsr1.S, anticorps fb40b11, anticorps fusl, anticorps wu:fb40b11, anticorps wu:fb75g09, anticorps zgc:55864, anticorps EWS RNA binding protein 1, anticorps Ewing sarcoma breakpoint region 1, anticorps EWS RNA-binding protein 1, anticorps EWS RNA-binding protein 1a, anticorps EWS RNA binding protein 1 L homeolog, anticorps EWS RNA-binding protein 1b, anticorps EWSR1, anticorps Ewsr1, anticorps ewsr1a, anticorps ewsr1, anticorps ewsr1.L, anticorps ewsr1b
    Sujet
    This gene encodes a multifunctional protein that is involved in various cellular processes, including gene expression, cell signaling, and RNA processing and transport. The protein includes an N-terminal transcriptional activation domain and a C-terminal RNA-binding domain. Chromosomal translocations between this gene and various genes encoding transcription factors result in the production of chimeric proteins that are involved in tumorigenesis. These chimeric proteins usually consist of the N-terminal transcriptional activation domain of this protein fused to the C-terminal DNA-binding domain of the transcription factor protein. Mutations in this gene, specifically a t(11,22)(q24,q12) translocation, are known to cause Ewing sarcoma as well as neuroectodermal and various other tumors. Alternative splicing of this gene results in multiple transcript variants. Related pseudogenes have been identified on chromosomes 1 and 14.

    Synonyms: bK984G1.4 antibody|bK984G1.4 Ewing sarcoma breakpoint region 1 protein antibody|Ewing sarcoma breakpoint region 1 antibody|Ewing sarcoma breakpoint region 1 protein antibody|Ewings sarcoma EWS Fli1 type 1 oncogene antibody|EWS antibody|EWS oncogene antibody| EWS RNA binding protein 1 antibody|EWS_HUMAN antibody|EWSR 1 antibody|Ewsr1 antibody|EWSR1 protein antibody|RNA binding protein EWS antibody|RNA-binding protein EWS antibody
    ID gène
    2130
    UniProt
    Q01844
Vous êtes ici:
Support technique