EWSR1 anticorps (Middle Region)

N° du produit ABIN3043825

Détail du produit anti-EWSR1 anticorps

Antigène: EWSR1 (Ewing Sarcoma Breakpoint Region 1 (EWSR1))

Épitope: AA 369-399, Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp EWSR1 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Fonction: Rabbit IgG polyclonal antibody for RNA-binding protein EWS(EWSR1) detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Séquence: NDSVTLDDLA DFFKQCGVVK MNKRTGQPMI H

Réactivité croisée (Details): No cross reactivity with other proteins.

Attributs du produit: Rabbit IgG polyclonal antibody for RNA-binding protein EWS(EWSR1) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: EWS RNA-binding protein 1
Protein Name: RNA-binding protein EWS

Purification: Immunogen affinity purified.

Immunogène: A synthetic peptide corresponding to a sequence in the middle region of human EWSR1 (369-399aa NDSVTLDDLADFFKQCGVVKMNKRTGQPMIH), different from the related mouse sequence by one amino acid.

Isotype: IgG

Information d'application

Indications d'application: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Rat
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Mouse, Rat, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Commentaires:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Conseil sur la manipulation: Avoid repeated freezing and thawing.

Stock: 4 °C/-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Détails sur EWSR1

Antigène: EWSR1 (Ewing Sarcoma Breakpoint Region 1 (EWSR1))

Autre désignation: EWSR1 (EWSR1 Produits)

Synonymes: anticorps EWS, anticorps bK984G1.4, anticorps AU018891, anticorps Ews, anticorps Ewsh, anticorps EWSR1, anticorps fc04c01, anticorps wu:fc04c01, anticorps DKFZp459K1116, anticorps ewsr1, anticorps ewsr1.S, anticorps fb40b11, anticorps fusl, anticorps wu:fb40b11, anticorps wu:fb75g09, anticorps zgc:55864, anticorps EWS RNA binding protein 1, anticorps Ewing sarcoma breakpoint region 1, anticorps EWS RNA-binding protein 1, anticorps EWS RNA-binding protein 1a, anticorps EWS RNA binding protein 1 L homeolog, anticorps EWS RNA-binding protein 1b, anticorps EWSR1, anticorps Ewsr1, anticorps ewsr1a, anticorps ewsr1, anticorps ewsr1.L, anticorps ewsr1b

Sujet: This gene encodes a multifunctional protein that is involved in various cellular processes, including gene expression, cell signaling, and RNA processing and transport. The protein includes an N-terminal transcriptional activation domain and a C-terminal RNA-binding domain. Chromosomal translocations between this gene and various genes encoding transcription factors result in the production of chimeric proteins that are involved in tumorigenesis. These chimeric proteins usually consist of the N-terminal transcriptional activation domain of this protein fused to the C-terminal DNA-binding domain of the transcription factor protein. Mutations in this gene, specifically a t(11,22)(q24,q12) translocation, are known to cause Ewing sarcoma as well as neuroectodermal and various other tumors. Alternative splicing of this gene results in multiple transcript variants. Related pseudogenes have been identified on chromosomes 1 and 14.

Synonyms: bK984G1.4 antibody|bK984G1.4 Ewing sarcoma breakpoint region 1 protein antibody|Ewing sarcoma breakpoint region 1 antibody|Ewing sarcoma breakpoint region 1 protein antibody|Ewings sarcoma EWS Fli1 type 1 oncogene antibody|EWS antibody|EWS oncogene antibody| EWS RNA binding protein 1 antibody|EWS_HUMAN antibody|EWSR 1 antibody|Ewsr1 antibody|EWSR1 protein antibody|RNA binding protein EWS antibody|RNA-binding protein EWS antibody

ID gène: 2130

UniProt: Q01844