FMO3 anticorps (C-Term)
-
- Antigène Voir toutes FMO3 Anticorps
- FMO3 (Flavin Containing Monooxygenase 3 (FMO3))
-
Épitope
- AA 404-433, C-Term
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp FMO3 est non-conjugé
-
Application
- Western Blotting (WB)
- Fonction
- Rabbit IgG polyclonal antibody for Dimethylaniline monooxygenase [N-oxide-forming] 3(FMO3) detection. Tested with WB in Human,Mouse, Rat.
- Séquence
- DMMNDINEKM EKKRKWFGKS ETIQTDYIVY
- Réactivité croisée (Details)
- No cross reactivity with other proteins.
- Attributs du produit
-
Rabbit IgG polyclonal antibody for Dimethylaniline monooxygenase [N-oxide-forming] 3(FMO3) detection. Tested with WB in Human,Mouse, Rat.
Gene Name: flavin containing monooxygenase 3
Protein Name: Dimethylaniline monooxygenase [N-oxide-forming] 3 - Purification
- Immunogen affinity purified.
- Immunogène
- A synthetic peptide corresponding to a sequence at the C-terminus of human FMO3 (404-433aa DMMNDINEKMEKKRKWFGKSETIQTDYIVY), different from the related mouse sequence by eight amino acids, and from the related rat sequence by six amino acids.
- Isotype
- IgG
- Top Product
- Discover our top product FMO3 Anticorps primaire
-
-
- Indications d'application
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users. - Commentaires
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB.
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Concentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Agent conservateur
- Sodium azide
- Précaution d'utilisation
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Conseil sur la manipulation
- Avoid repeated freezing and thawing.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Antigène
- FMO3 (Flavin Containing Monooxygenase 3 (FMO3))
- Autre désignation
- FMO3 (FMO3 Produits)
- Synonymes
- anticorps MGC107820, anticorps FMOII, anticorps TMAU, anticorps dJ127D3.1, anticorps FM03, anticorps AW111792, anticorps flavin containing monooxygenase 3, anticorps flavin containing monooxygenase 3 L homeolog, anticorps FMO3, anticorps fmo3, anticorps fmo3.L, anticorps Fmo3
- Sujet
-
FMO3 (Flavin-containing Monooxygenase 3) is an enzyme that in humans is encoded by the FMO3 gene. The mammalian flavin-containing monooxygenases (FMO) represent a multigene family whose gene products are localized in the endoplasmic reticulum of many tissues. The FMO3 gene contains 1 noncoding and 8 coding exons. And the FMO3 gene is mapped on 1q24.3. Using quantitative RNase protection assays, FMO3 is present in low abundance in fetal liver and lung and in adult kidney and lung, and in much greater abundance in adult liver. By Western blot analysis of human liver microsomal samples ranging from 8 weeks gestation to 18 years of age, FMO1 is the major fetal isoform and FMO3 is the major adult isoform. FMO3 was expressed at intermediate levels until 11 years of age when a gender-independent increase in FMO3 expression was observed during puberty. Sufferers of trimethylaminuria may display a reduced ability to metabolize substrates for FMO3 such as nicotine. FMO3 metabolizes a number of drugs, including amphetamine, clozapine, deprenyl, metamphetamine, tamoxifen, ethionamide, thiacetazone, and sulindac sulfide.
Synonyms: Dimethylaniline monooxygenase [N oxide forming] 3 antibody|Dimethylaniline monooxygenase [N-oxide-forming] 3 antibody|Dimethylaniline monooxygenase 3 antibody|Dimethylaniline oxidase 3 antibody|dJ127D3.1 antibody|Flavin containing monooxygenase 3 antibody|FMO 3 antibody|FMO form 2 antibody|FMO II antibody|FMO3 antibody|FMO3_HUMAN antibody|FMOII antibody|Hepatic flavin containing monooxygenase 3 antibody|Hepatic flavin-containing monooxygenase 3 antibody|MGC34400 antibody|TMAU antibody|Trimethylamine monooxygenase antibody - ID gène
- 2328
- UniProt
- P31513
-