GNAQ anticorps (N-Term)

N° du produit ABIN3043833

Détail du produit anti-GNAQ anticorps

Antigène: GNAQ (Guanine Nucleotide Binding Protein (G Protein), Q Polypeptide (GNAQ))

Épitope: AA 102-138, N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp GNAQ est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Fonction: Rabbit IgG polyclonal antibody for Guanine nucleotide-binding protein G(q) subunit alpha(GNAQ) detection. Tested with WB, IHC-P in Human,Rat,Mouse.

Séquence: KYEHNKAHAQ LVREVDVEKV SAFENPYVDA IKSLWND

Réactivité croisée (Details): No cross reactivity with other proteins.

Attributs du produit: Rabbit IgG polyclonal antibody for Guanine nucleotide-binding protein G(q) subunit alpha(GNAQ) detection. Tested with WB, IHC-P in Human,Rat,Mouse.
Gene Name: guanine nucleotide binding protein (G protein), q polypeptide
Protein Name: Guanine nucleotide-binding protein G(q) subunit alpha

Purification: Immunogen affinity purified.

Immunogène: A synthetic peptide corresponding to a sequence at the N-terminus of human GNAQ (102-138aa KYEHNKAHAQLVREVDVEKVSAFENPYVDAIKSLWND), identical to the related mouse and rat sequences.

Isotype: IgG

Information d'application

Indications d'application: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Mouse, Rat, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Commentaires:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Conseil sur la manipulation: Avoid repeated freezing and thawing.

Stock: 4 °C/-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Détails sur GNAQ

Antigène: GNAQ (Guanine Nucleotide Binding Protein (G Protein), Q Polypeptide (GNAQ))

Autre désignation: GNAQ (GNAQ Produits)

Synonymes: anticorps si:ch73-270f14.2, anticorps CMC1, anticorps G-ALPHA-q, anticorps GAQ, anticorps SWS, anticorps Galphaq, anticorps Gnaq, anticorps g-alpha-q, anticorps gaq, anticorps gnaqb, anticorps 1110005L02Rik, anticorps 6230401I02Rik, anticorps AA408290, anticorps AW060788, anticorps Dsk1, anticorps Dsk10, anticorps Gq, anticorps GqI, anticorps guanine nucleotide binding protein (G protein), q polypeptide, anticorps G protein subunit alpha q, anticorps guanine nucleotide binding protein (G protein), q polypeptide S homeolog, anticorps guanine nucleotide binding protein, alpha q polypeptide, anticorps gnaq, anticorps GNAQ, anticorps Gnaq, anticorps gnaq.S

Sujet: Guanine nucleotide-binding protein G(q) subunit alpha is a protein that in humans is encoded by the GNAQ gene. Guanine nucleotide-binding proteins are a family of heterotrimeric proteins that couple cell surface, 7-transmembrane domain receptors to intracellular signaling pathways. Receptor activation catalyzes the exchange of GDP for GTP bound to the inactive G protein alpha subunit resulting in a conformational change and dissociation of the complex. The G protein alpha and beta-gamma subunits are capable of regulating various cellular effectors. Activation is terminated by a GTPase intrinsic to the G-alpha subunit. G-alpha-q is the alpha subunit of one of the heterotrimeric GTP-binding proteins that mediates stimulation of phospholipase C-beta. Mutations in this gene have been found associated to cases of Sturge-Weber syndrome and port-wine stains.

Synonyms: CMC1 antibody|G alpha Q antibody|G protein alpha Q antibody|G-ALPHA-q antibody|GAQ antibody|GNAQ antibody|GNAQ_HUMAN antibody|guanine nucleotide binding protein (G protein), q polypeptide antibody|Guanine nucleotide binding protein alpha q antibody|guanine nucleotide binding protein G protein q polypeptide antibody|Guanine nucleotide binding protein G q subunit alpha antibody|Guanine nucleotide-binding protein alpha-q antibody|Guanine nucleotide-binding protein G(q) subunit alpha antibody|SWS antibody

ID gène: 2776

UniProt: P50148

Pathways: Signalistation JAK/STAT, Thyroid Hormone Synthesis, Myometrial Relaxation and Contraction