Tel:
+49 (0)241 95 163 153
Fax:
+49 (0)241 95 163 155
E-Mail:
orders@anticorps-enligne.fr

HRAS anticorps (C-Term)

HRAS Reactivité: Souris, Rat WB Hôte: Lapin Polyclonal unconjugated
N° du produit ABIN3043845
  • Antigène Voir toutes HRAS Anticorps
    HRAS (HRas proto-oncogene, GTPase (HRAS))
    Épitope
    • 15
    • 15
    • 13
    • 13
    • 7
    • 6
    • 5
    • 3
    • 3
    • 2
    • 2
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    AA 101-137, C-Term
    Reactivité
    • 72
    • 56
    • 41
    • 7
    • 4
    • 3
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    Souris, Rat
    Hôte
    • 94
    • 10
    • 1
    Lapin
    Clonalité
    • 94
    • 11
    Polyclonal
    Conjugué
    • 41
    • 11
    • 10
    • 6
    • 3
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    Cet anticorp HRAS est non-conjugé
    Application
    • 90
    • 43
    • 26
    • 26
    • 15
    • 15
    • 10
    • 10
    • 7
    • 4
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    Western Blotting (WB)
    Fonction
    Rabbit IgG polyclonal antibody for GTPase Hras(HRAS) detection. Tested with WB in Human,Mouse,Rat.
    Séquence
    KRVKDSDDVP MVLVGNKCDL AARTVESRQA QDLAR
    Réactivité croisée (Details)
    Predicted Cross Reactivity: human
    No cross reactivity with other proteins.
    Predicted Cross Reactivity: Species predicted to be fit for the product based on sequence similarities.
    Attributs du produit
    Rabbit IgG polyclonal antibody for GTPase Hras(HRAS) detection. Tested with WB in Human,Mouse,Rat.
    Gene Name: Harvey rat sarcoma viral oncogene homolog
    Protein Name: GTPase Hras
    Purification
    Immunogen affinity purified.
    Immunogène
    A synthetic peptide corresponding to a sequence at the C-terminus of human GTPase HRAS (101-137aa KRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLAR SY), identical to the related mouse and rat sequences.
    Isotype
    IgG
    Top Product
    Discover our top product HRAS Anticorps primaire
  • Indications d'application
    WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Mouse, Rat, Predicted Species: Human
    Notes: Tested Species: Species with positive results. Predicted Species: Species predicted to be fit for the product based on sequence similarities.
    Other applications have not been tested. Optimal dilutions should be determined by end users.
    Commentaires

    Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

    Restrictions
    For Research Use only
  • Format
    Lyophilized
    Reconstitution
    Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
    Concentration
    500 μg/mL
    Buffer
    Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
    Agent conservateur
    Sodium azide
    Précaution d'utilisation
    This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
    Conseil sur la manipulation
    Avoid repeated freezing and thawing.
    Stock
    4 °C/-20 °C
    Stockage commentaire
    At -20°C for one year. After reconstitution, at 4°C for one month.
    It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
  • Antigène
    HRAS (HRas proto-oncogene, GTPase (HRAS))
    Autre désignation
    HRAS (HRAS Produits)
    Synonymes
    anticorps C-BAS/HAS, anticorps C-H-RAS, anticorps C-HA-RAS1, anticorps CTLO, anticorps H-RASIDX, anticorps HAMSV, anticorps HRAS1, anticorps K-RAS, anticorps N-RAS, anticorps RASH1, anticorps hras, anticorps zgc:110250, anticorps HRAS, anticorps H-RAS, anticorps c-H-ras, anticorps H-Ras, anticorps K-Ras, anticorps hras1, anticorps rash1, anticorps ras, anticorps N-Ras, anticorps c-bas/has, anticorps H-ras, anticorps Ha-ras, anticorps Harvey-ras, anticorps Hras-1, anticorps Kras2, anticorps c-Ha-ras, anticorps c-rasHa, anticorps hrasl, anticorps zgc:110734, anticorps HRas proto-oncogene, GTPase, anticorps v-Ha-ras Harvey rat sarcoma viral oncogene homolog a, anticorps neuroblastoma RAS viral (v-ras) oncogene homolog pseudogene, anticorps Harvey rat sarcoma viral oncogene homolog L homeolog, anticorps Harvey rat sarcoma viral oncogene homolog, anticorps Harvey rat sarcoma virus oncogene, anticorps NRAS proto-oncogene, GTPase, anticorps -Ha-ras Harvey rat sarcoma viral oncogene homolog b, anticorps HRAS, anticorps hrasa, anticorps LOC733587, anticorps Hras, anticorps hras.L, anticorps hras, anticorps NRAS, anticorps hrasb
    Sujet
    GTPase HRas, also known as transforming protein p21, is an enzyme that in humans is encoded by the HRAS gene. This gene belongs to the Ras oncogene family, whose members are related to the transforming genes of mammalian sarcoma retroviruses. The products encoded by these genes function in signal transduction pathways. These proteins can bind GTP and GDP, and they have intrinsic GTPase activity. This protein undergoes a continuous cycle of de- and re-palmitoylation, which regulates its rapid exchange between the plasma membrane and the Golgi apparatus. Mutations in this gene cause Costello syndrome, a disease characterized by increased growth at the prenatal stage, growth deficiency at the postnatal stage, predisposition to tumor formation, mental retardation, skin and musculoskeletal abnormalities, distinctive facial appearance and cardiovascular abnormalities. Defects in this gene are implicated in a variety of cancers, including bladder cancer, follicular thyroid cancer, and oral squamous cell carcinoma. Multiple transcript variants, which encode different isoforms, have been identified for this gene.

    Synonyms: C BAS/HAS antibody|c H ras antibody|C HA RAS1 antibody|c has/bas p21 protein antibody|c ras Ki 2 activated oncogene antibody|c-H-ras antibody|CTLO antibody|GTP and GDP binding peptide B antibody|GTPase HRas, N-terminally processed antibody|H Ras 1 antibody|H RASIDX antibody|H-Ras-1 antibody|Ha Ras antibody|Ha Ras1 proto oncoprotein antibody|Ha-Ras antibody|HAMSV antibody|Harvey rat sarcoma viral oncogene homolog antibody|Harvey rat sarcoma viral oncoprotein antibody|HRAS antibody|HRAS1 antibody|K ras antibody|N ras antibody|p19 H RasIDX protein antibody|p21ras antibody|Ras family small GTP binding protein H Ras antibody|RASH_HUMAN antibody|RASH1 antibody| Transformation gene oncogene HAMSV antibody|Transforming protein p21 antibody|v Ha ras Harvey rat sarcoma viral oncogene homolog antibody|VH Ras antibody|vHa RAS antibody
    ID gène
    3265
    UniProt
    P01112
    Pathways
    Signalisation p53, Signalisation MAPK, Signalisation RTK, Fc-epsilon Receptor Signaling Pathway, EGFR Signaling Pathway, Neurotrophin Signaling Pathway, Hepatitis C, Autophagy, Signaling Events mediated by VEGFR1 and VEGFR2, Signaling of Hepatocyte Growth Factor Receptor, Regulation of long-term Neuronal Synaptic Plasticity, VEGF Signaling, BCR Signaling
Vous êtes ici:
Support technique