HSD11B2 anticorps (C-Term)

N° du produit ABIN3043846

Détail du produit anti-HSD11B2 anticorps

Antigène: HSD11B2 (Hydroxysteroid (11-Beta) Dehydrogenase 2 (HSD11B2))

Épitope: AA 277-309, C-Term

Reactivité: Humain, Rat, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp HSD11B2 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Fonction: Rabbit IgG polyclonal antibody for Corticosteroid 11-beta-dehydrogenase isozyme 2(HSD11B2) detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Séquence: EKRKQLLLAN LPQELLQAYG KDYIEHLHGQ FLH

Réactivité croisée (Details): No cross reactivity with other proteins.

Attributs du produit: Rabbit IgG polyclonal antibody for Corticosteroid 11-beta-dehydrogenase isozyme 2(HSD11B2) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: hydroxysteroid (11-beta) dehydrogenase 2
Protein Name: Corticosteroid 11-beta-dehydrogenase isozyme 2

Purification: Immunogen affinity purified.

Immunogène: A synthetic peptide corresponding to a sequence at the C-terminus of human HSD11B2 (277-309aa EKRKQLLLANLPQELLQAYGKDYIEHLHGQFLH), different from the related mouse sequence by five amino acids, and from the related rat sequence by three amino acids.

Isotype: IgG

Information d'application

Indications d'application: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Rat
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Mouse, Rat, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Commentaires:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Conseil sur la manipulation: Avoid repeated freezing and thawing.

Stock: 4 °C/-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Détails sur HSD11B2

Antigène: HSD11B2 (Hydroxysteroid (11-Beta) Dehydrogenase 2 (HSD11B2))

Autre désignation: HSD11B2 (HSD11B2 Produits)

Synonymes: anticorps MGC81883, anticorps 11-HSD2, anticorps AME, anticorps AME1, anticorps HSD11K, anticorps HSD2, anticorps SDR9C3, anticorps 11HSD2, anticorps HSD11B2, anticorps hydroxysteroid (11-beta) dehydrogenase 2 L homeolog, anticorps hydroxysteroid 11-beta dehydrogenase 2, anticorps hsd11b2.L, anticorps HSD11B2, anticorps Hsd11b2

Sujet: Corticosteroid 11-β-dehydrogenase isozyme 2, also known as 11-β-hydroxysteroid dehydrogenase 2, is an enzyme that in humans is encoded by the HSD11B2 gene. There are at least two isozymes of the corticosteroid 11-beta-dehydrogenase, a microsomal enzyme complex responsible for the interconversion of cortisol and cortisone. The type I isozyme has both 11-beta-dehydrogenase (cortisol to cortisone) and 11-oxoreductase (cortisone to cortisol) activities. The type II isozyme, encoded by this gene, has only 11-beta-dehydrogenase activity. In aldosterone-selective epithelial tissues such as the kidney, the type II isozyme catalyzes the glucocorticoid cortisol to the inactive metabolite cortisone, thus preventing illicit activation of the mineralocorticoid receptor. In tissues that do not express the mineralocorticoid receptor, such as the placenta and testis, it protects cells from the growth-inhibiting and/or pro-apoptotic effects of cortisol, particularly during embryonic development. Mutations in this gene cause the syndrome of apparent mineralocorticoid excess and hypertension.

Synonyms: 11 beta HSD2 antibody|11 beta hydroxysteroid dehydrogenase type 2 antibody|11 DH2 antibody|11-beta-HSD2 antibody|11-beta-hydroxysteroid dehydrogenase type 2 antibody|11-DH2 antibody|AME antibody|AME1 antibody|Corticosteroid 11 beta dehydrogenase isozyme 2 antibody|Corticosteroid 11-beta-dehydrogenase isozyme 2 antibody|DHI2_HUMAN antibody|HSD11B2 antibody|HSD11K antibody|HSD2 antibody| Hydroxysteroid 11 beta dehydrogenase 2 antibody|Hydroxysteroid 11 beta dehydrogenase isoenzyme 2 antibody|NAD dependent 11 beta hydroxysteroid dehydrogenase antibody|NAD-dependent 11-beta-hydroxysteroid dehydrogenase antibody|SDR9C3 antibody|Short chain dehydrogenase/reductase family 9C, member 3 antibody

ID gène: 3291

UniProt: P80365

Pathways: Steroid Hormone Biosynthesis, Regulation of Systemic Arterial Blood Pressure by Hormones