HSPA2 anticorps (C-Term)

N° du produit ABIN3043850

Détail du produit anti-HSPA2 anticorps

Antigène: HSPA2 (Heat Shock 70kDa Protein 2 (HSPA2))

Épitope: AA 564-598, C-Term

Reactivité: Humain, Rat, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp HSPA2 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Fonction: Rabbit IgG polyclonal antibody for Heat shock-related 70 kDa protein 2(HSPA2) detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Séquence: KISEQDKNKI LDKCQEVINW LDRNQMAEKD EYEHK

Réactivité croisée (Details): No cross reactivity with other proteins.

Attributs du produit: Rabbit IgG polyclonal antibody for Heat shock-related 70 kDa protein 2(HSPA2) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: heat shock 70 kDa protein 2
Protein Name: Heat shock-related 70 kDa protein 2

Purification: Immunogen affinity purified.

Immunogène: A synthetic peptide corresponding to a sequence at the C-terminus of human HSPA2 (564-598aa KISEQDKNKILDKCQEVINWLDRNQMAEKDEYEHK), identical to the related mouse and rat sequences.

Isotype: IgG

Information d'application

Indications d'application: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Mouse, Rat, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Commentaires:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Conseil sur la manipulation: Avoid repeated freezing and thawing.

Stock: 4 °C/-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Détails sur HSPA2

Antigène: HSPA2 (Heat Shock 70kDa Protein 2 (HSPA2))

Autre désignation: HSPA2 (HSPA2 Produits)

Synonymes: anticorps HSP70-2, anticorps HSP70-3, anticorps HSPA2, anticorps DKFZp468B217, anticorps 70kDa, anticorps HSP70.2, anticorps HSP70A2, anticorps Hsp70-2, anticorps Hspt70, anticorps Hst70, anticorps HSPA3, anticorps heat shock protein family A (Hsp70) member 2, anticorps heat shock protein Hsp20, anticorps heat shock 70kDa protein 2, anticorps heat shock protein 2, anticorps heat shock protein family A member 2, anticorps HSPA2, anticorps hspA2, anticorps Hspa2

Sujet: HSPA2 (heat shock 70 kDa protein 2) is also known as HEAT-SHOCK PROTEIN, 70-KD, 2, HSP70-2, HEAT-SHOCK PROTEIN, 70-KD, 3 or HSP70-3. Analysis of the sequence indicated that HSPA2 is the human homolog of the murine Hsp70-2 gene, with 91.7 % identity in the nucleotide coding sequence and 98.2 % in the corresponding amino acid sequence. HSPA2 has less amino acid homology to the other members of the human HSP70 gene family. HSPA2 is constitutively expressed in most tissues, with very high levels in testis and skeletal muscle. The HSPA2 gene is located on chromosome 14q22-q24. Immunohistochemical analysis detected weak expression of HSPA2 in spermatocytes and stronger expression in spermatids and in the tail of mature sperm. HSPA2 may be critical to sperm maturation through its role as a protein chaperone.

Synonyms: 70 kDa antibody|DAQB 147D11.1 001 antibody|Hcp70.2 antibody|Heat shock 70 kDa protein 2 antibody|heat shock 70 kDa protein 1A antibody| Heat shock protein 2 antibody|heat shock protein 70 antibody|Heat shock protein 70.2 antibody|Heat shock related 70 kDa protein 2 antibody|Heat shock-related 70 kDa protein 2 antibody|Heat-shock protein, 70-KD, 2 antibody|Heat-shock protein, 70-KD, 3 antibody| HSP70 2 antibody|HSP70 3 antibody|Hsp70-2 antibody|HSP70-3 antibody|HSP70.2 antibody|HSP70A2 antibody|HSP72 antibody|HSP72_HUMAN antibody|HSPA2 antibody|Hspt70 antibody|Hst70 antibody|MGC58299 antibody|MGC7795 antibody|MGC93458 antibody|OTTHUMP00000180664 antibody|Testis-specific heat shock protein-related antibody|XXbac BCX40G17.3 001 antibody

ID gène: 3306

UniProt: P54652