Tel:
+49 (0)241 95 163 153
Fax:
+49 (0)241 95 163 155
E-Mail:
orders@anticorps-enligne.fr

IGFBP3 anticorps (C-Term)

IGFBP3 Reactivité: Humain, Rat WB, ELISA, IHC (p) Hôte: Lapin Polyclonal unconjugated
N° du produit ABIN3043859
  • Antigène Voir toutes IGFBP3 Anticorps
    IGFBP3 (Insulin-Like Growth Factor Binding Protein 3 (IGFBP3))
    Épitope
    • 15
    • 11
    • 8
    • 8
    • 7
    • 4
    • 3
    • 3
    • 3
    • 3
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    AA 214-252, C-Term
    Reactivité
    • 99
    • 41
    • 32
    • 5
    • 5
    • 3
    • 2
    • 1
    • 1
    • 1
    • 1
    Humain, Rat
    Hôte
    • 100
    • 15
    • 1
    • 1
    Lapin
    Clonalité
    • 101
    • 16
    Polyclonal
    Conjugué
    • 61
    • 15
    • 7
    • 5
    • 3
    • 3
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    Cet anticorp IGFBP3 est non-conjugé
    Application
    • 100
    • 46
    • 46
    • 15
    • 13
    • 13
    • 8
    • 7
    • 7
    • 5
    • 5
    • 2
    • 1
    • 1
    Western Blotting (WB), ELISA, Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
    Fonction
    Rabbit IgG polyclonal antibody for Insulin-like growth factor-binding protein 3(IGFBP3) detection. Tested with WB, IHC-P, ELISA in Human,Rat.
    Séquence
    RREMEDTLNH LKFLNVLSPR GVHIPNCDKK GFYKKKQCR
    Réactivité croisée (Details)
    No cross reactivity with other proteins.
    Attributs du produit
    Rabbit IgG polyclonal antibody for Insulin-like growth factor-binding protein 3(IGFBP3) detection. Tested with WB, IHC-P, ELISA in Human,Rat.
    Gene Name: insulin-like growth factor binding protein 3
    Protein Name: Insulin-like growth factor-binding protein 3
    Purification
    Immunogen affinity purified.
    Immunogène
    A synthetic peptide corresponding to a sequence at the C-terminus of human IGFBP-3 (214-252aa RREMEDTLNHLKFLNVLSPRGVHIPNCDKKGFYKKKQCR), identical to the related mouse and rat sequences.
    Isotype
    IgG
    Top Product
    Discover our top product IGFBP3 Anticorps primaire
  • Indications d'application
    WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Rat
    IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
    ELISA: Concentration: 0.1-0.5 μg/mL, Tested Species: Human

    Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.
    Commentaires

    Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

    Restrictions
    For Research Use only
  • Format
    Lyophilized
    Reconstitution
    Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
    Concentration
    500 μg/mL
    Buffer
    Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
    Agent conservateur
    Sodium azide
    Précaution d'utilisation
    This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
    Conseil sur la manipulation
    Avoid repeated freezing and thawing.
    Stock
    4 °C/-20 °C
    Stockage commentaire
    At -20°C for one year. After reconstitution, at 4°C for one month.
    It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
  • Pu, Wen, Liu, Zheng, Xiao, Xu, Wang, Li, Zhang: "shRNA constructs targeting IGFBP-3 alleviate age related erectile dysfunction in the rat." dans: The Journal of urology, Vol. 192, Issue 3, pp. 990-6, (2014) (PubMed).

    Pu, Zheng, Zhang, Xiao, Xu, Liu, Wang, Wen, Zhou, Wu: "Higher expression of mRNA and protein of insulin-like growth factor binding protein-3 in old rat penile tissues: implications for erectile dysfunction." dans: The journal of sexual medicine, Vol. 8, Issue 8, pp. 2181-90, (2011) (PubMed).

  • Antigène
    IGFBP3 (Insulin-Like Growth Factor Binding Protein 3 (IGFBP3))
    Autre désignation
    IGFBP3 (IGFBP3 Produits)
    Synonymes
    anticorps BP-53, anticorps IBP3, anticorps AI649005, anticorps IGFBP-3, anticorps IGgfbp3, anticorps IGF-BP3, anticorps zgc:91788, anticorps IGFBP3, anticorps igfbp3, anticorps insulin like growth factor binding protein 3, anticorps insulin-like growth factor binding protein 3, anticorps IGFBP3, anticorps Igfbp3, anticorps igfbp3, anticorps IGFBP-3, anticorps LOC100305016
    Sujet
    IGFBP3, Insulin-like growth fator-binding protein 3, is a member of the insulin-like growth factor binding protein (IGFBP) family and encodes a protein with an IGFBP domain and a thyroglobulin type-I domain. IGFBP3 is located on chromosome 7. The protein forms a ternary complex with insulin-like growth factor acid-labile subunit (IGFALS) and either insulin-like growth factor (IGF) I or II. In this form, it circulates in the plasma, prolonging the half-life of IGFs and altering their interaction with cell surface receptors. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.

    Synonyms: Acid stable subunit of the 140 K IGF complex antibody|Binding protein 29 antibody|Binding protein 53 antibody|BP 53 antibody|BP53 antibody|Growth hormone dependent binding protein antibody|IBP 3 antibody|IBP-3 antibody|IBP3 antibody|IBP3_HUMAN antibody|IGF binding protein 3 antibody|IGF-binding protein 3 antibody|IGFBP 3 antibody|IGFBP-3 antibody|IGFBP3 antibody|Insulin Like Growth Factor Binding Protein 3 antibody|Insulin-like growth factor-binding protein 3 antibody
    ID gène
    3486
    UniProt
    P17936
    Pathways
    Myometrial Relaxation and Contraction, Regulation of Muscle Cell Differentiation, Skeletal Muscle Fiber Development, Regulation of Carbohydrate Metabolic Process, Autophagy, Smooth Muscle Cell Migration, Growth Factor Binding
Vous êtes ici:
Support technique