Tel:
+49 (0)241 95 163 153
Fax:
+49 (0)241 95 163 155
E-Mail:
orders@anticorps-enligne.fr

KCNA2 anticorps (C-Term)

KCNA2 Reactivité: Souris, Rat WB Hôte: Lapin Polyclonal unconjugated
N° du produit ABIN3043865
  • Antigène Voir toutes KCNA2 Anticorps
    KCNA2 (Potassium Voltage-Gated Channel, Shaker-Related Subfamily, Member 2 (KCNA2))
    Épitope
    • 13
    • 7
    • 7
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    AA 466-499, C-Term
    Reactivité
    • 32
    • 13
    • 7
    • 1
    Souris, Rat
    Hôte
    • 32
    • 3
    Lapin
    Clonalité
    • 34
    • 2
    Polyclonal
    Conjugué
    • 21
    • 2
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    Cet anticorp KCNA2 est non-conjugé
    Application
    • 27
    • 16
    • 15
    • 8
    • 3
    • 2
    • 1
    • 1
    • 1
    • 1
    Western Blotting (WB)
    Fonction
    Rabbit IgG polyclonal antibody for Potassium voltage-gated channel subfamily A member 2(KCNA2) detection. Tested with WB in Human,Mouse,Rat.
    Séquence
    NNSNEDFREE NLKTANCTLA NTNYVNITKM LTDV
    Réactivité croisée (Details)
    Predicted Cross Reactivity: human
    No cross reactivity with other proteins.
    Predicted Cross Reactivity: Species predicted to be fit for the product based on sequence similarities.
    Attributs du produit
    Rabbit IgG polyclonal antibody for Potassium voltage-gated channel subfamily A member 2(KCNA2) detection. Tested with WB in Human,Mouse,Rat.
    Gene Name: potassium channel, voltage gated shaker related subfamily A, member 2
    Protein Name: Potassium voltage-gated channel subfamily A member 2
    Purification
    Immunogen affinity purified.
    Immunogène
    A synthetic peptide corresponding to a sequence at the C-terminus of human Kv1.2 (466-499aa NNSNEDFREENLKTANCTLANTNYVNITKMLTDV), identical to the related mouse and rat sequences.
    Isotype
    IgG
    Top Product
    Discover our top product KCNA2 Anticorps primaire
  • Indications d'application
    WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Mouse, Rat, Predicted Species: Human
    Notes: Tested Species: Species with positive results. Predicted Species: Species predicted to be fit for the product based on sequence similarities.
    Other applications have not been tested. Optimal dilutions should be determined by end users.
    Commentaires

    Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

    Restrictions
    For Research Use only
  • Format
    Lyophilized
    Reconstitution
    Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
    Concentration
    500 μg/mL
    Buffer
    Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
    Agent conservateur
    Sodium azide
    Précaution d'utilisation
    This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
    Conseil sur la manipulation
    Avoid repeated freezing and thawing.
    Stock
    4 °C/-20 °C
    Stockage commentaire
    At -20°C for one year. After reconstitution, at 4°C for one month.
    It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
  • Antigène
    KCNA2 (Potassium Voltage-Gated Channel, Shaker-Related Subfamily, Member 2 (KCNA2))
    Autre désignation
    KCNA2 (KCNA2 Produits)
    Synonymes
    anticorps KCNA2, anticorps kcna2, anticorps HBK5, anticorps HK4, anticorps HUKIV, anticorps KV1.2, anticorps MK2, anticorps NGK1, anticorps RBK2, anticorps Akr6a4, anticorps ENSMUSG00000074335, anticorps Gm10672, anticorps Kca1-2, anticorps Kv1.2, anticorps Mk-2, anticorps BK2, anticorps XSha2, anticorps k(v)1.2, anticorps kcna2-a, anticorps kv1.2, anticorps potassium voltage-gated channel subfamily A member 2, anticorps potassium channel, voltage gated shaker related subfamily A, member 1, anticorps potassium voltage-gated channel, shaker-related subfamily, member 2, anticorps potassium channel, voltage gated shaker related subfamily A, member 2 S homeolog, anticorps KCNA2, anticorps kcna1, anticorps Kcna2, anticorps LOC100537815, anticorps kcna2.S
    Sujet
    Potassium voltage-gated channel subfamily A member 2, also known as Kv1.2, is a protein that in humans is encoded by the KCNA2 gene. Potassium channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. Four sequence-related potassium channel genes - shaker, shaw, shab, and shal - have been identified in Drosophila, and each has been shown to have human homolog(s). This gene encodes a member of the potassium channel, voltage-gated, shaker-related subfamily. This member contains six membrane-spanning domains with a shaker-type repeat in the fourth segment. It belongs to the delayed rectifier class, members of which allow nerve cells to efficiently repolarize following an action potential. The coding region of this gene is intronless, and the gene is clustered with genes KCNA3 and KCNA10 on chromosome 1.

    Synonyms: Akr6a4 antibody|BK2 antibody|HBK5 antibody|HK4 antibody|HUKIV antibody|Kca1 2 antibody|kcna2 antibody|KV1.2 antibody|MGC50217 antibody|Mk 2 antibody|MK2 antibody|NGK1 antibody|Potassium voltage gated channel shaker related subfamily member 2 antibody|Potassium voltage-gated channel subfamily A member 2 antibody|RBK2 antibody|Voltage gated potassium channel subunit Kv1.2 antibody
    ID gène
    3737
    UniProt
    P16389
Vous êtes ici:
Support technique