MAP2K3 anticorps (C-Term)

N° du produit ABIN3043874

Détail du produit anti-MAP2K3 anticorps

Antigène: MAP2K3 (Mitogen-Activated Protein Kinase Kinase 3 (MAP2K3))

Épitope: AA 311-347, C-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp MAP2K3 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Fonction: Rabbit IgG polyclonal antibody for Dual specificity mitogen-activated protein kinase kinase 3(MAP kinase kinase 3/MAPKK 3)(MAP2K3) detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Séquence: AERMSYLELM EHPFFTLHKT KKTDIAAFVK EILGEDS

Réactivité croisée (Details): No cross reactivity with other proteins.

Attributs du produit: Rabbit IgG polyclonal antibody for Dual specificity mitogen-activated protein kinase kinase 3(MAP kinase kinase 3/MAPKK 3)(MAP2K3) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: mitogen-activated protein kinase kinase 3
Protein Name: Dual specificity mitogen-activated protein kinase kinase 3(MAP kinase kinase 3/MAPKK 3)

Purification: Immunogen affinity purified.

Immunogène: A synthetic peptide corresponding to a sequence at the C-terminus of human MEK3 (311-347aa AERMSYLELMEHPFFTLHKTKKTDIAAFVKEILGEDS), identical to the related mouse sequence.

Isotype: IgG

Information d'application

Indications d'application: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Mouse, Rat, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Commentaires:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Conseil sur la manipulation: Avoid repeated freezing and thawing.

Stock: 4 °C/-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Références pour anticorps anti-MAP2K3 (ABIN3043874)

Cheng, Wang, Wang, Wang, Du, Lou: "Silencing Ras-Related C3 Botulinum Toxin Substrate 1 Inhibits Growth and Migration of Hypopharyngeal Squamous Cell Carcinoma via the P38 Mitogen-Activated Protein Kinase Signaling Pathway." dans: Medical science monitor : international medical journal of experimental and clinical research, Vol. 24, pp. 768-781, (2018) (PubMed).

Xu, Zhang, Wei, Jia, Ge, Zhang, Liu: "MicroRNA-21 promotes hepatocellular carcinoma HepG2 cell proliferation through repression of mitogen-activated protein kinase-kinase 3." dans: BMC cancer, Vol. 13, pp. 469, (2013) (PubMed).

Détails sur MAP2K3

Antigène: MAP2K3 (Mitogen-Activated Protein Kinase Kinase 3 (MAP2K3))

Autre désignation: MAP2K3 (MAP2K3 Produits)

Synonymes: anticorps MAPKK3, anticorps MEK3, anticorps MKK3, anticorps PRKMK3, anticorps SAPKK-2, anticorps SAPKK2, anticorps AW212142, anticorps Prkmk3, anticorps mMKK3b, anticorps Mkk3, anticorps mitogen-activated protein kinase kinase 3, anticorps mitogen activated protein kinase kinase 3, anticorps MAP kinase activator XMEK3, anticorps MAP2K3, anticorps Map2k3, anticorps map2k3

Sujet: Dual specificity mitogen-activated protein kinase kinase 3 is an enzyme that in humans is encoded by the MAP2K3 gene. The protein encoded by this gene is a dual specificity protein kinase that belongs to the MAP kinase kinase family. This kinase is activated by mitogenic and environmental stress, and participates in the MAP kinase-mediated signaling cascade. It phosphorylates and thus activates MAPK14/p38-MAPK. And this kinase can be activated by insulin, and is necessary for the expression of glucose transporter. Expression of RAS oncogene is found to result in the accumulation of the active form of this kinase, which thus leads to the constitutive activation of MAPK14, and confers oncogenic transformation of primary cells. Rampoldi et al. (1997) localized the MAP2K3 gene to 17q11.2.

Synonyms: AW212142 antibody|Dual specificity mitogen activated protein kinase kinase 3 antibody|Dual specificity mitogen-activated protein kinase kinase 3 antibody|ERK kinase 3 antibody|MAP kinase kinase 3 antibody|MAP2K 3 antibody|map2k3 antibody|MAPK ERK kinase 3 antibody|MAPK kinase 3 antibody|MAPK/ERK kinase 3 antibody|MAPKK 3 antibody|MAPKK3 antibody|MEK 3 antibody|MEK3 antibody|Mitogen activated protein kinase kinase 3 antibody|MKK 3 antibody|MKK3 antibody| mMKK 3b antibody| mMKK3b antibody|MP2K3_HUMAN antibody|MPK 3 antibody|PRKMK 3 antibody|PRKMK3 antibody|Protein kinase mitogen activated kinase 3 antibody|protein kinase, mitogen-activated, kinase 3 antibody|SAPK kinase 2 antibody|SAPKK 2 antibody|SAPKK2 antibody|SKK2 antibody|Stress activated protein kinase kinase 2 antibody| zMKK 3 antibody

ID gène: 5606

UniProt: P46734

Pathways: Signalisation MAPK, Signalisation TLR, Activation of Innate immune Response, Toll-Like Receptors Cascades, Autophagy, Signaling Events mediated by VEGFR1 and VEGFR2