MMP8 anticorps (N-Term)

N° du produit ABIN3043883

Détail du produit anti-MMP8 anticorps

Antigène: MMP8 (Matrix Metallopeptidase 8 (Neutrophil Collagenase) (MMP8))

Épitope: AA 120-157, N-Term

Reactivité: Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp MMP8 est non-conjugé

Application: Western Blotting (WB), ELISA, Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Fonction: Rabbit IgG polyclonal antibody for Neutrophil collagenase(MMP8) detection. Tested with WB, IHC-P, ELISA in Mouse,Rat.

Séquence: HTPQLSRAEV KTAIEKAFHV WSVASPLTFT EILQGEAD

Réactivité croisée (Details): No cross reactivity with other proteins.

Attributs du produit: Rabbit IgG polyclonal antibody for Neutrophil collagenase(MMP8) detection. Tested with WB, IHC-P, ELISA in Mouse,Rat.
Gene Name: matrix metallopeptidase 8 (neutrophil collagenase)
Protein Name: Neutrophil collagenase

Purification: Immunogen affinity purified.

Immunogène: A synthetic peptide corresponding to a sequence at the N-terminus of mouse MMP-8 (120-157aa HTPQLSRAEVKTAIEKAFHVWSVASPLTFTEILQGEAD), different from the related human sequence by eleven amino acids, and from the related rat sequence by nine amino acids.

Isotype: IgG

Information d'application

Indications d'application: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Mouse, Rat
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Mouse, Rat, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
ELISA: Concentration: 0.1-0.5 μg/mL, Tested Species: Mouse

Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Commentaires:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Conseil sur la manipulation: Avoid repeated freezing and thawing.

Stock: 4 °C/-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Références pour anticorps anti-MMP8 (ABIN3043883)

Liu, Li, Liang, Li, Jiang, Chu, Yang: "Hydrogen sulfide attenuates myocardial fibrosis in diabetic rats through the JAK/STAT signaling pathway." dans: International journal of molecular medicine, Vol. 41, Issue 4, pp. 1867-1876, (2018) (PubMed).

Gao, Tang, He, Liu, Mao, Ji, Lin, Wu: "Glycyrrhizic acid alleviates bleomycin-induced pulmonary fibrosis in rats." dans: Frontiers in pharmacology, Vol. 6, pp. 215, (2015) (PubMed).

Zhong, Wang, Jian: "Expression of matrix metalloproteinases-8 and -9 and their tissue inhibitor in the condyles of diabetic rats with mandibular advancement." dans: Experimental and therapeutic medicine, Vol. 8, Issue 5, pp. 1357-1364, (2014) (PubMed).

Détails sur MMP8

Antigène: MMP8 (Matrix Metallopeptidase 8 (Neutrophil Collagenase) (MMP8))

Autre désignation: MMP8 (MMP8 Produits)

Synonymes: anticorps MMP8, anticorps BB138268, anticorps CLG1, anticorps HNC, anticorps MMP-8, anticorps PMNL-CL, anticorps matrix metallopeptidase 8, anticorps neutrophil collagenase, anticorps MMP8, anticorps Mmp8, anticorps LOC100339790

Sujet: MMP8 (Matrix metalloproteinase 8) is a member of the family of matrix metalloproteinases. It is distinct from the collagenase of skin fibroblasts and synovial cells in substrate specificity and immunologic crossreactivity. MMP8 is mapped to 11q21-q22. MMP8 is an enzyme that degrades fibrillar collagens imparting strength to the fetal membranes, is expressed by leukocytes and chorionic cytotrophoblast cells. The enzyme exhibits 58 % homology to human fibroblast collagenase and has the same domain structure. It consists of a 20-residue signal peptide, and an 80-residue propeptide that is lost on autolytic activation by cleavage of an M-L bond. MMP8 was found to possess 57 % identity with the deduced protein sequence for fibroblast collagenase with 72 % chemical similarity. Matrix metalloproteinases (MMPs) have fundamental roles in tumor progression, but most clinical trials with MMP inhibitors have not shown improvements in individuals with cancer. MMP8 has a paradoxical protective role in cancer and provides a genetic model to evaluate the molecular basis of gender differences in cancer susceptibility.

Synonyms: CLG 1 antibody|CLG1 antibody|Collagenase 1 antibody|Collagenase 1 neutrophil antibody|HNC antibody|Matrix metallopeptidase 8 (neutrophil collagenase) antibody|Matrix metalloprotease 8 antibody|Matrix metalloproteinase-8 antibody|MMP 8 antibody|MMP-8 antibody| Mmp8 antibody| MMP8_HUMAN antibody|Neutrophil collagenase antibody|PMNL CL antibody|PMNL collagenase antibody|PMNL-CL antibody|PMNLCL antibody

ID gène: 17394

UniProt: O70138