Tel:
+49 (0)241 95 163 153
Fax:
+49 (0)241 95 163 155
E-Mail:
orders@anticorps-enligne.fr

OGT anticorps (C-Term)

OGT Reactivité: Humain, Souris, Rat WB, IHC (p) Hôte: Lapin Polyclonal unconjugated
N° du produit ABIN3043893
  • Antigène Voir toutes OGT Anticorps
    OGT (O-Linked N-Acetylglucosamine (GlcNAc) Transferase (UDP-N-Acetylglucosamine:polypeptide-N-Acetylglucosaminyl Transferase) (OGT))
    Épitope
    • 5
    • 5
    • 3
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    AA 1008-1046, C-Term
    Reactivité
    • 53
    • 28
    • 26
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    Humain, Souris, Rat
    Hôte
    • 51
    • 2
    • 1
    Lapin
    Clonalité
    • 42
    • 12
    Polyclonal
    Conjugué
    • 29
    • 3
    • 3
    • 3
    • 3
    • 3
    • 3
    • 3
    • 3
    • 1
    Cet anticorp OGT est non-conjugé
    Application
    • 30
    • 16
    • 15
    • 9
    • 8
    • 7
    • 4
    • 3
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
    Fonction
    Rabbit IgG polyclonal antibody for UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit(OGT) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
    Séquence
    NTKQYTMELE RLYLQMWEHY AAGNKPDHMI KPVEVTESA
    Réactivité croisée (Details)
    No cross reactivity with other proteins.
    Attributs du produit
    Rabbit IgG polyclonal antibody for UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit(OGT) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
    Gene Name: O-linked N-acetylglucosamine (GlcNAc) transferase
    Protein Name: UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit
    Purification
    Immunogen affinity purified.
    Immunogène
    A synthetic peptide corresponding to a sequence at the C-terminus of human OGT (1008-1046aa NTKQYTMELERLYLQMWEHYAAGNKPDHMIKPVEVTESA), identical to the related mouse and rat sequences.
    Isotype
    IgG
    Top Product
    Discover our top product OGT Anticorps primaire
  • Indications d'application
    WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
    IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Mouse, Rat, Predicted Species: Human, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
    Notes: Tested Species: Species with positive results. Predicted Species: Species predicted to be fit for the product based on sequence similarities. Other applications have not been tested. Optimal dilutions should be determined by end users.
    Commentaires

    Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

    Restrictions
    For Research Use only
  • Format
    Lyophilized
    Reconstitution
    Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
    Concentration
    500 μg/mL
    Buffer
    Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
    Agent conservateur
    Sodium azide
    Précaution d'utilisation
    This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
    Conseil sur la manipulation
    Avoid repeated freezing and thawing.
    Stock
    4 °C/-20 °C
    Stockage commentaire
    At -20°C for one year. After reconstitution, at 4°C for one month.
    It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
  • Antigène
    OGT (O-Linked N-Acetylglucosamine (GlcNAc) Transferase (UDP-N-Acetylglucosamine:polypeptide-N-Acetylglucosaminyl Transferase) (OGT))
    Autre désignation
    OGT (OGT Produits)
    Synonymes
    anticorps BcDNA:GH04245, anticorps CG10392, anticorps Dmel\\CG10392, anticorps OGT, anticorps Ogt, anticorps P1201, anticorps SXC, anticorps Sxc, anticorps l(2)02637, anticorps l(2)NC130, anticorps sxc/Ogt, anticorps fm81g08, anticorps ogt, anticorps wu:fc12b01, anticorps wu:fm81g08, anticorps HRNT1, anticorps O-GLCNAC, anticorps 1110038P24Rik, anticorps 4831420N21Rik, anticorps AI115525, anticorps Ogtl, anticorps O-linked N-acetylglucosamine (GlcNAc) transferase L homeolog, anticorps super sex combs, anticorps O-linked N-acetylglucosamine (GlcNAc) transferase, tandem duplicate 1, anticorps O-linked N-acetylglucosamine (GlcNAc) transferase, anticorps O-linked GlcNAc transferase, anticorps o-linked GlcNAc transferase, anticorps O-linked N-acetylglucosamine (GlcNAc) transferase (UDP-N-acetylglucosamine:polypeptide-N-acetylglucosaminyl transferase), anticorps ogt.L, anticorps sxc, anticorps ogt.1, anticorps OGT, anticorps ogt, anticorps GL50803_12081, anticorps GL50803_41701, anticorps THAPSDRAFT_264441, anticorps spyA, anticorps Ogt
    Sujet
    O-linked N-acetylglucosamine (O-GlcNAc) transferase (OGT) is an enzyme that in humans is encoded by the OGT gene. This gene encodes a glycosyltransferase that catalyzes the addition of a single N-acetylglucosamine in O-glycosidic linkage to serine or threonine residues. Since both phosphorylation and glycosylation compete for similar serine or threonine residues, the two processes may compete for sites, or they may alter the substrate specificity of nearby sites by steric or electrostatic effects. The protein contains multiple tetratricopeptide repeats that are required for optimal recognition of substrates. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.

    Synonyms: FLJ23071 antibody|GlcNAc transferase antibody|HRNT1 antibody|MGC22921 antibody|O GlcNAc antibody|O GlcNAc transferase p110 subunit antibody|O GlcNAc transferase subunit p110 antibody|O linked N acetylglucosamine (GlcNAc) transferase (UDP N acetylglucosamine: polypeptide N acetylglucosaminyl transferase) antibody|O linked N acetylglucosamine (GlcNAc) transferase antibody|O linked N acetylglucosamine transferase 110 kDa subunit antibody|O-GlcNAc transferase subunit p110 antibody|O-linked N-acetylglucosamine transferase 110 kDa subunit antibody|ogt antibody|OGT1_HUMAN antibody|UDP N acetylglucosamine peptide N acetylglucosaminyltransferase 110 kDa subunit antibody|UDP N acetylglucosamine peptide N acetylglucosaminyltransferase GlcNAc transferase antibody|UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit antibody|UDP-N-acetylglucosamine:polypeptide-N-acetylglucosaminyl transferase antibody|Uridinediphospho N acetylglucosamine:polypeptide beta N acetylglucosaminyl transferase antibody
    ID gène
    8473
    UniProt
    O15294
    Pathways
    Regulation of Carbohydrate Metabolic Process
Vous êtes ici:
Support technique