Tel:
+49 (0)241 95 163 153
Fax:
+49 (0)241 95 163 155
E-Mail:
orders@anticorps-enligne.fr

PPP1R12A anticorps (N-Term)

PPP1R12A Reactivité: Humain, Souris WB, IHC (p) Hôte: Lapin Polyclonal unconjugated
N° du produit ABIN3043902
  • Antigène Voir toutes PPP1R12A Anticorps
    PPP1R12A (Myosin Phosphatase, Target Subunit 1 (PPP1R12A))
    Épitope
    • 26
    • 23
    • 7
    • 7
    • 7
    • 6
    • 3
    • 3
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    AA 1-40, N-Term
    Reactivité
    • 92
    • 79
    • 67
    • 6
    • 5
    • 4
    • 4
    • 3
    • 3
    • 3
    • 3
    • 3
    • 2
    • 1
    Humain, Souris
    Hôte
    • 109
    • 2
    • 1
    Lapin
    Clonalité
    • 110
    • 2
    Polyclonal
    Conjugué
    • 49
    • 7
    • 5
    • 5
    • 5
    • 5
    • 5
    • 5
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    Cet anticorp PPP1R12A est non-conjugé
    Application
    • 57
    • 26
    • 26
    • 24
    • 17
    • 12
    • 6
    • 6
    • 4
    • 2
    • 1
    • 1
    Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
    Fonction
    Rabbit IgG polyclonal antibody for Protein phosphatase 1 regulatory subunit 12A(PPP1R12A) detection. Tested with WB, IHC-P in Human,Mouse.
    Séquence
    MKMADAKQKR NEQLKRWIGS ETDLEPPVVK RQKTKVKFDD
    Réactivité croisée (Details)
    No cross reactivity with other proteins.
    Attributs du produit
    Rabbit IgG polyclonal antibody for Protein phosphatase 1 regulatory subunit 12A(PPP1R12A) detection. Tested with WB, IHC-P in Human,Mouse.
    Gene Name: protein phosphatase 1, regulatory subunit 12A
    Protein Name: Protein phosphatase 1 regulatory subunit 12A
    Purification
    Immunogen affinity purified.
    Immunogène
    A synthetic peptide corresponding to a sequence at the N-terminus of human PPP1R12A (1-40aa MKMADAKQKRNEQLKRWIGSETDLEPPVVKRQKTKVKFDD), identical to the related mouse and rat sequences.
    Isotype
    IgG
    Top Product
    Discover our top product PPP1R12A Anticorps primaire
  • Indications d'application
    WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse
    IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
    Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.
    Commentaires

    Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

    Restrictions
    For Research Use only
  • Format
    Lyophilized
    Reconstitution
    Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
    Concentration
    500 μg/mL
    Buffer
    Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
    Agent conservateur
    Sodium azide
    Précaution d'utilisation
    This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
    Conseil sur la manipulation
    Avoid repeated freezing and thawing.
    Stock
    4 °C/-20 °C
    Stockage commentaire
    At -20°C for one year. After reconstitution, at 4°C for one month.
    It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
  • Yan, Wang, Jiang, Chen, He, Mang, Shao, Xu: "The role of Rho/Rho-kinase pathway and the neuroprotective effects of fasudil in chronic cerebral ischemia." dans: Neural regeneration research, Vol. 10, Issue 9, pp. 1441-9, (2015) (PubMed).

  • Antigène
    PPP1R12A (Myosin Phosphatase, Target Subunit 1 (PPP1R12A))
    Autre désignation
    PPP1R12A (PPP1R12A Produits)
    Synonymes
    anticorps 1200015F06Rik, anticorps 5730577I22Rik, anticorps AA792106, anticorps AV099298, anticorps D10Ertd625e, anticorps Mypt1, anticorps M130, anticorps MBS, anticorps MYPT1, anticorps M110, anticorps MBSP, anticorps protein phosphatase 1, regulatory (inhibitor) subunit 12A, anticorps protein phosphatase 1 regulatory subunit 12A, anticorps protein phosphatase 1, regulatory subunit 12A, anticorps Ppp1r12a, anticorps PPP1R12A
    Sujet
    PPP1R12A (Protein phosphatase 1 regulatory subunit 12A), also called MYPT1 (Myosin phosphatase target subunit 1), is an enzyme that in humans is encoded by the PPP1R12A gene. PPP1R12A is one of the subunits of myosin phosphatase. Sequencing analysis showed that human PPP1R12A contains 1,030 amino acids with a calculated molecular mass of approximately 115 kD. The PPP1R12A gene is mapped on 12q21.2-q21.3. PPP1R12A is the protein that regulates PP1 function in smooth muscle relaxation. The cellular MYPT1-PP1-delta -specific inhibitor CPI17 caused a loss of merlin function characterized by merlin phosphorylation, Ras activation, and transformation. Jin et al. concluded that PPP1R12A and its substrate merlin are part of a previously undescribed tumor suppressor cascade that can be hindered in two ways, by mutation of the NF2 gene and by upregulation of the oncoprotein CPI17.

    Synonyms: M130 antibody|MBS antibody|MGC133042 antibody|Myosin binding subunit antibody|Myosin phosphatase target subunit 1 antibody|Myosin phosphatase targeting subunit 1 antibody| Myosin phosphatase-targeting subunit 1 antibody|MYPT 1 antibody|MYPT1 antibody|MYPT1_HUMAN antibody|PPP1R12A antibody|Protein phosphatase 1 regulatory inhibitor subunit 12A antibody| Protein phosphatase 1 regulatory subunit 12A antibody|Protein phosphatase 1, regulatory (inhibitor) subunit 12A antibody|Protein phosphatase myosin binding subunit antibody| Protein phosphatase myosin-binding subunit antibody
    ID gène
    4659
    UniProt
    O14974
    Pathways
    M Phase
Vous êtes ici:
Support technique