Peroxiredoxin 4 anticorps (C-Term)

N° du produit ABIN3043905

Détail du produit anti-Peroxiredoxin 4 anticorps

Antigène: Peroxiredoxin 4 (PRDX4)

Épitope: AA 178-2081, C-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Peroxiredoxin 4 est non-conjugé

Application: Western Blotting (WB), Immunocytochemistry (ICC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Fonction: Rabbit IgG polyclonal antibody for Peroxiredoxin-4(PRDX4) detection. Tested with WB, IHC-P, ICC in Human,Mouse,Rat.

Séquence: SDLTHQISKD YGVYLEDSGH TLRGLFIIDD K

Réactivité croisée (Details): No cross reactivity with other proteins.

Attributs du produit: Rabbit IgG polyclonal antibody for Peroxiredoxin-4(PRDX4) detection. Tested with WB, IHC-P, ICC in Human,Mouse,Rat.
Gene Name: peroxiredoxin 4
Protein Name: Peroxiredoxin-4

Purification: Immunogen affinity purified.

Immunogène: A synthetic peptide corresponding to a sequence at the C-terminus of human Peroxiredoxin 4 (178-2081aa SDLTHQISKDYGVYLEDSGHTLRGLFIIDDK), different from the related mouse and rat sequences by one amino acid.

Isotype: IgG

Information d'application

Indications d'application: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat, The detection limit for Peroxiredoxin 4 is approximately 0.1 ng/lane under reducing conditions.
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Mouse, Rat, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
ICC: Concentration: 0.5-1 μg/mL, Tested Species: Human
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Commentaires:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P) and ICC.

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Conseil sur la manipulation: Avoid repeated freezing and thawing.

Stock: 4 °C/-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Détails sur Peroxiredoxin 4

Antigène: Peroxiredoxin 4 (PRDX4)

Autre désignation: PRDX4 (PRDX4 Produits)

Synonymes: anticorps MGC82793, anticorps prdx4, anticorps MGC79732, anticorps PRDX4, anticorps AOE37-2, anticorps PRX-4, anticorps AOE372, anticorps Prx-iv, anticorps Prx4, anticorps TRANK, anticorps fb59c09, anticorps wu:fb59c09, anticorps zgc:162938, anticorps peroxiredoxin 4, anticorps peroxiredoxin 4 L homeolog, anticorps PRDX4, anticorps prdx4.L, anticorps prdx4, anticorps Prdx4

Sujet: PRDX4 (peroxiredoxin 4) is also known as AOE37-2. The protein encoded by this gene is an antioxidant enzyme and belongs to the peroxiredoxin family. Functional analysis showed that PRDX4 protects glutamine synthetase from inactivation. Yeast 2-hybrid, immunoprecipitation, and immunoblot analyses indicated that PRDX4 and PRDX1 are capable of homodimerization and heterodimerization with each other but not with the mitochondrial PRDX3. Gel mobility shift and immunoblot analysis found that PRDX4 depletes NFKB binding activity together with a reduction in the amounts of p50, p65, and phosphorylated IKBA, as well as a reduction in the expression of HIV-1 viral proteins. Expression of PRDX4, alone or with PRDX1, increased the resistance of yeast cells to oxidant-induced toxicity. Jin et al. suggested PRDX4 modulates IKBA phosphorylation in the cytoplasm and thus affects a peroxiredoxin-dependent redox step.

Synonyms: Antioxidant enzyme 372 antibody|Antioxidant enzyme AOE372 antibody|AOE37 2 antibody|AOE37-2 antibody|AOE372 antibody|EC 1.11.1.15 antibody|Peroxiredoxin IV antibody|Peroxiredoxin-4 antibody|Peroxiredoxin4 antibody|PRDX 4 antibody|PRDX4 antibody|PRDX4_HUMAN antibody|PRX 4 antibody|Prx IV antibody|Prx-IV antibody|PRX4 antibody|PrxIV antibody|Thioredoxin dependent peroxide reductase A0372 antibody|Thioredoxin Peroxidase (Antioxidant Enzyme) antibody|Thioredoxin peroxidase antibody|Thioredoxin peroxidase AO372 antibody|Thioredoxin-dependent peroxide reductase A0372 antibody|TRANK antibody

ID gène: 10549

UniProt: Q13162