Tel:
+49 (0)241 95 163 153
Fax:
+49 (0)241 95 163 155
E-Mail:
orders@anticorps-enligne.fr

PTP4A2 anticorps (N-Term)

PTP4A2 Reactivité: Humain, Souris, Rat WB, IHC (p) Hôte: Lapin Polyclonal unconjugated
N° du produit ABIN3043911
  • Antigène Voir toutes PTP4A2 Anticorps
    PTP4A2 (Protein tyrosine Phosphatase Type IVA, Member 2 (PTP4A2))
    Épitope
    • 15
    • 5
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    AA 40-69, N-Term
    Reactivité
    Humain, Souris, Rat
    Hôte
    • 36
    • 3
    Lapin
    Clonalité
    • 36
    • 3
    Polyclonal
    Conjugué
    • 14
    • 3
    • 3
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    Cet anticorp PTP4A2 est non-conjugé
    Application
    • 13
    • 13
    • 12
    • 9
    • 7
    • 5
    • 5
    • 3
    • 3
    • 2
    • 1
    • 1
    Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
    Fonction
    Rabbit IgG polyclonal antibody for Protein tyrosine phosphatase type IVA 2(PTP4A2) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
    Séquence
    TTLVRVCDAT YDKAPVEKEG IHVLDWPFDD
    Réactivité croisée (Details)
    No cross reactivity with other proteins.
    Attributs du produit
    Rabbit IgG polyclonal antibody for Protein tyrosine phosphatase type IVA 2(PTP4A2) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
    Gene Name: protein tyrosine phosphatase type IVA, member 2
    Protein Name: Protein tyrosine phosphatase type IVA 2
    Purification
    Immunogen affinity purified.
    Immunogène
    A synthetic peptide corresponding to a sequence at the N-terminus of human PTP4A2 (40-69aa TTLVRVCDATYDKAPVEKEGIHVLDWPFDD), identical to the related mouse and rat sequences.
    Isotype
    IgG
    Top Product
    Discover our top product PTP4A2 Anticorps primaire
  • Indications d'application
    WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
    IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
    Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.
    Commentaires

    Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

    Restrictions
    For Research Use only
  • Format
    Lyophilized
    Reconstitution
    Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
    Concentration
    500 μg/mL
    Buffer
    Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
    Agent conservateur
    Sodium azide
    Précaution d'utilisation
    This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
    Conseil sur la manipulation
    Avoid repeated freezing and thawing.
    Stock
    4 °C/-20 °C
    Stockage commentaire
    At -20°C for one year. After reconstitution, at 4°C for one month.
    It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
  • Antigène
    PTP4A2 (Protein tyrosine Phosphatase Type IVA, Member 2 (PTP4A2))
    Autre désignation
    PTP4A2 (PTP4A2 Produits)
    Synonymes
    anticorps wu:fc05f09, anticorps wu:fi84b06, anticorps zgc:101724, anticorps MGC53390, anticorps MGC80084, anticorps MGC132077, anticorps PTP4A2, anticorps ptp4a2, anticorps Prl-2, anticorps HH13, anticorps HH7-2, anticorps HU-PP-1, anticorps OV-1, anticorps PRL-2, anticorps PRL2, anticorps PTP4A, anticorps PTPCAAX2, anticorps ptp-IV1a, anticorps ptp-IV1b, anticorps protein tyrosine phosphatase type IVA, member 2b, anticorps protein tyrosine phosphatase 4a2, anticorps protein tyrosine phosphatase type IVA, member 2, anticorps protein tyrosine phosphatase type IVA, member 2 L homeolog, anticorps ptp4a2b, anticorps ptp4a2, anticorps PTP4A2, anticorps ptp4a2.L, anticorps Ptp4a2
    Sujet
    Protein tyrosine phosphatase type IVA 2 is an enzyme that in humans is encoded by the PTP4A2 gene. The protein encoded by this gene belongs to a small class of the protein tyrosine phosphatase (PTP) family. PTPs are cell signaling molecules that play regulatory roles in a variety of cellular processes. PTPs in this class contain a protein tyrosine phosphatase catalytic domain and a characteristic C-terminal prenylation motif. This PTP has been shown to primarily associate with plasmic and endosomal membrane through its C-terminal prenylation. This PTP was found to interact with the beta-subunit of Rab geranylgeranyltransferase II (beta GGT II), and thus may function as a regulator of GGT II activity. Overexpression of this gene in mammalian cells conferred a transformed phenotype, which suggested its role in tumorigenesis. Alternatively spliced transcript variants have been described. Related pseudogenes exist on chromosomes 11, 12 and 17.

    Synonyms: BM 008 antibody|EC 3.1.3.48 antibody|HH 13 antibody|HH13 antibody|HH7 2 antibody|HU PP 1 antibody|HUPP 1 antibody|HUPP1 antibody|OV 1 antibody|OV1 antibody|phosphatase of regenerating liver 2 antibody|PRL 2 antibody|PRL2 antibody|Protein tyrosine phosphatase 4a2 antibody|protein tyrosine phosphatase IVA antibody|protein tyrosine phosphatase IVA2 antibody|Protein tyrosine phosphatase of regenerating liver 2 antibody|protein tyrosine phosphatase type IVA 2 antibody|Protein tyrosine phosphatase type IVA member 2 isoform 1 antibody|protein tyrosine phosphatase type IVA, member 2 antibody|PTP (CAAXII) antibody|ptp IV1a antibody|ptp IV1b antibody|PTP4A antibody|PTPCAAX2 antibody|TP4A2_HUMAN antibody
    ID gène
    8073
    UniProt
    Q12974
Vous êtes ici:
Support technique