PTP4A2 anticorps (N-Term)
-
- Antigène Voir toutes PTP4A2 Anticorps
- PTP4A2 (Protein tyrosine Phosphatase Type IVA, Member 2 (PTP4A2))
-
Épitope
- AA 40-69, N-Term
- Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp PTP4A2 est non-conjugé
-
Application
- Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
- Fonction
- Rabbit IgG polyclonal antibody for Protein tyrosine phosphatase type IVA 2(PTP4A2) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
- Séquence
- TTLVRVCDAT YDKAPVEKEG IHVLDWPFDD
- Réactivité croisée (Details)
- No cross reactivity with other proteins.
- Attributs du produit
-
Rabbit IgG polyclonal antibody for Protein tyrosine phosphatase type IVA 2(PTP4A2) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: protein tyrosine phosphatase type IVA, member 2
Protein Name: Protein tyrosine phosphatase type IVA 2 - Purification
- Immunogen affinity purified.
- Immunogène
- A synthetic peptide corresponding to a sequence at the N-terminus of human PTP4A2 (40-69aa TTLVRVCDATYDKAPVEKEGIHVLDWPFDD), identical to the related mouse and rat sequences.
- Isotype
- IgG
- Top Product
- Discover our top product PTP4A2 Anticorps primaire
-
-
- Indications d'application
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users. - Commentaires
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Concentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Agent conservateur
- Sodium azide
- Précaution d'utilisation
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Conseil sur la manipulation
- Avoid repeated freezing and thawing.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Antigène
- PTP4A2 (Protein tyrosine Phosphatase Type IVA, Member 2 (PTP4A2))
- Autre désignation
- PTP4A2 (PTP4A2 Produits)
- Synonymes
- anticorps wu:fc05f09, anticorps wu:fi84b06, anticorps zgc:101724, anticorps MGC53390, anticorps MGC80084, anticorps MGC132077, anticorps PTP4A2, anticorps ptp4a2, anticorps Prl-2, anticorps HH13, anticorps HH7-2, anticorps HU-PP-1, anticorps OV-1, anticorps PRL-2, anticorps PRL2, anticorps PTP4A, anticorps PTPCAAX2, anticorps ptp-IV1a, anticorps ptp-IV1b, anticorps protein tyrosine phosphatase type IVA, member 2b, anticorps protein tyrosine phosphatase 4a2, anticorps protein tyrosine phosphatase type IVA, member 2, anticorps protein tyrosine phosphatase type IVA, member 2 L homeolog, anticorps ptp4a2b, anticorps ptp4a2, anticorps PTP4A2, anticorps ptp4a2.L, anticorps Ptp4a2
- Sujet
-
Protein tyrosine phosphatase type IVA 2 is an enzyme that in humans is encoded by the PTP4A2 gene. The protein encoded by this gene belongs to a small class of the protein tyrosine phosphatase (PTP) family. PTPs are cell signaling molecules that play regulatory roles in a variety of cellular processes. PTPs in this class contain a protein tyrosine phosphatase catalytic domain and a characteristic C-terminal prenylation motif. This PTP has been shown to primarily associate with plasmic and endosomal membrane through its C-terminal prenylation. This PTP was found to interact with the beta-subunit of Rab geranylgeranyltransferase II (beta GGT II), and thus may function as a regulator of GGT II activity. Overexpression of this gene in mammalian cells conferred a transformed phenotype, which suggested its role in tumorigenesis. Alternatively spliced transcript variants have been described. Related pseudogenes exist on chromosomes 11, 12 and 17.
Synonyms: BM 008 antibody|EC 3.1.3.48 antibody|HH 13 antibody|HH13 antibody|HH7 2 antibody|HU PP 1 antibody|HUPP 1 antibody|HUPP1 antibody|OV 1 antibody|OV1 antibody|phosphatase of regenerating liver 2 antibody|PRL 2 antibody|PRL2 antibody|Protein tyrosine phosphatase 4a2 antibody|protein tyrosine phosphatase IVA antibody|protein tyrosine phosphatase IVA2 antibody|Protein tyrosine phosphatase of regenerating liver 2 antibody|protein tyrosine phosphatase type IVA 2 antibody|Protein tyrosine phosphatase type IVA member 2 isoform 1 antibody|protein tyrosine phosphatase type IVA, member 2 antibody|PTP (CAAXII) antibody|ptp IV1a antibody|ptp IV1b antibody|PTP4A antibody|PTPCAAX2 antibody|TP4A2_HUMAN antibody - ID gène
- 8073
- UniProt
- Q12974
-