SFTPA1/ 2 (AA 206-237), (C-Term) anticorps
-
- Antigène
- SFTPA1/ 2
- Épitope
- AA 206-237, C-Term
- Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Inconjugué
- Application
- Western Blotting (WB), Immunohistochemistry (Frozen Sections) (IHC (fro)), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
- Fonction
- Rabbit IgG polyclonal antibody for Pulmonary surfactant-associated protein A1/Pulmonary surfactant-associated protein A2(SFTPA1/2) detection. Tested with WB, IHC-P, IHC-F in Human,Mouse,Rat.
- Séquence
- VNYTNWYRGE PAGRGKEQCV EMYTDGQWND RN
- Réactivité croisée (Details)
- No cross reactivity with other proteins.
- Attributs du produit
-
Rabbit IgG polyclonal antibody for Pulmonary surfactant-associated protein A1/Pulmonary surfactant-associated protein A2(SFTPA1/2) detection. Tested with WB, IHC-P, IHC-F in Human,Mouse,Rat.
Gene Name: surfactant protein A1/surfactant protein A2
Protein Name: Pulmonary surfactant-associated protein A1/Pulmonary surfactant-associated protein A2 - Purification
- Immunogen affinity purified.
- Immunogène
- A synthetic peptide corresponding to a sequence at the C-terminus of human SFTPA1/2(206-237aa VNYTNWYRGEPAGRGKEQCVEMYTDGQWNDRN), different from the related mouse sequence by four amino acids, and from the related rat sequence by five amino acids.
- Isotype
- IgG
-
-
- Indications d'application
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat , The detection limit for SFTPA1/2 is approximately 0.1 ng/lane under reducing conditions.
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Mouse, Rat, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
IHC-F: Concentration: 0.5-1 μg/mL, Tested Species: Mouse, Rat
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users. - Commentaires
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P) and ICC.
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Concentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Agent conservateur
- Sodium azide
- Précaution d'utilisation
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Conseil sur la manipulation
- Avoid repeated freezing and thawing.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Antigène
- SFTPA1/ 2
- Autre désignation
- SFTPA1/2
- Sujet
-
SFTPA1/2 is also known as SP-A. SFTPA1 encodes a lung surfactant protein that is a member of a subfamily of C-type lectins called collectins. The encoded protein binds specific carbohydrate moieties found on lipids and on the surface of microorganisms. This protein plays an essential role in surfactant homeostasis and in the defense against respiratory pathogens. Mutations in this gene are associated with idiopathic pulmonary fibrosis. Alternate splicing results in multiple transcript variants. SFTPA2 is one of several genes encoding pulmonary-surfactant associated proteins (SFTPA) located on chromosome 10. Mutations in this gene and a highly similar gene located nearby, which affect the highly conserved carbohydrate recognition domain, are associated with idiopathic pulmonary fibrosis. The current version of the assembly displays only a single centromeric SFTPA gene pair rather than the two gene pairs shown in the previous assembly which were thought to have resulted from a duplication.
Synonyms: 35 kDa pulmonary surfactant associated protein antibody|35 kDa pulmonary surfactant-associated protein antibody|Alveolar proteinosis protein antibody|COLEC4 antibody|Collectin 4 antibody|Collectin-4 antibody|FLJ50593 antibody|FLJ51913 antibody|FLJ61144 antibody|FLJ77898, antibody|FLJ79095 antibody|FLJ99559 antibody|MGC133365 antibody|MGC198590 antibody|OTTHUMP00000019928 antibody|OTTHUMP00000019929 antibody|OTTHUMP00000019930 antibody|OTTHUMP00000019931 antibody|PSAP antibody|PSP A antibody|PSP-A antibody|PSPA antibody|pulmonary surfactant -associated protein, 35-KD antibody|pulmonary surfactant apoprotein PSP-A antibody|pulmonary surfactant associated protein A1 antibody|Pulmonary surfactant-associated protein A1 antibody|SFTA1_HUMAN antibody|SFTP1 antibody|SFTPA1 antibody|SFTPA1B antibody|SP A antibody|SP A1 antibody|SP-A antibody|SP-A1 antibody|SPA antibody|SPA1 antibody|surfactant protein A1 antibody|surfactant protein A1 variant AB'D' 6A2 antibody|surfactant protein A1 variant AB'D' 6A3 antibody|surfactant protein A1 variant AB'D' 6A4 antibody|surfactant protein A1 variant ACD' 6A2 antibody|surfactant protein A1 variant ACD' 6A3 antibody|surfactant protein A1 variant ACD' 6A4 antibody|surfactant protein A1 variant AD' 6A antibody|surfactant protein A1 variant AD' 6A2 antibody|surfactant protein A1 variant AD' 6A3 antibody|surfactant protein A1 variant AD' 6A4 antibody|surfactant protein A1B antibody|surfactant, pulmonary associated protein A1A antibody|surfactant, pulmonary associated protein A1B antibody|surfactant-associated protein, pulmonary 1 antibody - ID gène
- 653509, 729238
- UniProt
- Q81Q82
-