UBA3 anticorps (C-Term)

N° du produit ABIN3043952

Détail du produit anti-UBA3 anticorps

Antigène: UBA3 (Ubiquitin-Like Modifier Activating Enzyme 3 (UBA3))

Épitope: AA 409-448, C-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp UBA3 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Fonction: Rabbit IgG polyclonal antibody for NEDD8-activating enzyme E1 catalytic subunit(UBA3) detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Séquence: KNRTLYLQSV TSIEERTRPN LSKTLKELGL VDGQELAVAD

Réactivité croisée (Details): No cross reactivity with other proteins.

Attributs du produit: Rabbit IgG polyclonal antibody for NEDD8-activating enzyme E1 catalytic subunit(UBA3) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: ubiquitin-like modifier activating enzyme 3
Protein Name: NEDD8-activating enzyme E1 catalytic subunit

Purification: Immunogen affinity purified.

Immunogène: A synthetic peptide corresponding to a sequence at the C-terminus of human UBE1C (409-448aa KNRTLYLQSVTSIEERTRPNLSKTLKELGLVDGQELAVAD), identical to the related mouse and rat sequences.

Isotype: IgG

Information d'application

Indications d'application: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Rat
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Mouse, Rat, Predicted Species: Human, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Predicted Species: Species predicted to be fit for the product based on sequence similarities. Other applications have not been tested. Optimal dilutions should be determined by end users.

Commentaires:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Conseil sur la manipulation: Avoid repeated freezing and thawing.

Stock: 4 °C/-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Détails sur UBA3

Antigène: UBA3 (Ubiquitin-Like Modifier Activating Enzyme 3 (UBA3))

Autre désignation: UBA3 (UBA3 Produits)

Synonymes: anticorps UBE1C, anticorps hUBA3, anticorps Ube1c, anticorps ube1c, anticorps wu:fb75e04, anticorps wu:fc37b11, anticorps zgc:55528, anticorps A830034N06Rik, anticorps AI256736, anticorps AI848246, anticorps AW546539, anticorps ubiquitin like modifier activating enzyme 3, anticorps ubiquitin-like modifier activating enzyme 3, anticorps ubiquitin like modifier activating enzyme 3 S homeolog, anticorps UBA3, anticorps Uba3, anticorps uba3, anticorps uba3.S

Sujet: NEDD8-activating enzyme E1 catalytic subunit is a protein that in humans is encoded by the UBA3 gene. The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the E1 ubiquitin-activating enzyme family. The encoded enzyme associates with AppBp1, an amyloid beta precursor protein binding protein, to form a heterodimer, and then the enzyme complex activates NEDD8, an ubiquitin-like protein, which regulates cell division, signaling and embryogenesis. Multiple alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.

Synonyms: DKFZp566J164 antibody|EC 6.3.2. antibody|hUba3 antibody|MGC22384 antibody|NEDD8 activating enzyme E1 catalytic subunit antibody|NEDD8 activating enzyme E1C antibody|Nedd8 activating enzyme hUba3 antibody|NEDD8-activating enzyme E1 catalytic subunit antibody|NEDD8-activating enzyme E1C antibody|uba3 antibody|UBA3 ubiquitin activating enzyme E1 homolog antibody|UBA3_HUMAN antibody|UBE1C antibody| Ubiquitin activating enzyme 3 antibody|Ubiquitin activating enzyme E1C antibody|Ubiquitin-activating enzyme 3 antibody|Ubiquitin-activating enzyme E1C antibody|Ubiquitin-like modifier-activating enzyme 3 antibody

ID gène: 9039