Tel:
+49 (0)241 95 163 153
Fax:
+49 (0)241 95 163 155
E-Mail:
orders@anticorps-enligne.fr

UBA3 anticorps (C-Term)

UBA3 Reactivité: Humain, Souris, Rat WB, IHC (p) Hôte: Lapin Polyclonal unconjugated
N° du produit ABIN3043952
  • Antigène Voir toutes UBA3 Anticorps
    UBA3 (Ubiquitin-Like Modifier Activating Enzyme 3 (UBA3))
    Épitope
    • 8
    • 8
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    AA 409-448, C-Term
    Reactivité
    • 31
    • 21
    • 11
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    Humain, Souris, Rat
    Hôte
    • 31
    Lapin
    Clonalité
    • 30
    • 1
    Polyclonal
    Conjugué
    • 14
    • 3
    • 2
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    Cet anticorp UBA3 est non-conjugé
    Application
    • 22
    • 17
    • 14
    • 3
    • 1
    Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
    Fonction
    Rabbit IgG polyclonal antibody for NEDD8-activating enzyme E1 catalytic subunit(UBA3) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
    Séquence
    KNRTLYLQSV TSIEERTRPN LSKTLKELGL VDGQELAVAD
    Réactivité croisée (Details)
    No cross reactivity with other proteins.
    Attributs du produit
    Rabbit IgG polyclonal antibody for NEDD8-activating enzyme E1 catalytic subunit(UBA3) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
    Gene Name: ubiquitin-like modifier activating enzyme 3
    Protein Name: NEDD8-activating enzyme E1 catalytic subunit
    Purification
    Immunogen affinity purified.
    Immunogène
    A synthetic peptide corresponding to a sequence at the C-terminus of human UBE1C (409-448aa KNRTLYLQSVTSIEERTRPNLSKTLKELGLVDGQELAVAD), identical to the related mouse and rat sequences.
    Isotype
    IgG
    Top Product
    Discover our top product UBA3 Anticorps primaire
  • Indications d'application
    WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Rat
    IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Mouse, Rat, Predicted Species: Human, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
    Notes: Tested Species: Species with positive results. Predicted Species: Species predicted to be fit for the product based on sequence similarities. Other applications have not been tested. Optimal dilutions should be determined by end users.
    Commentaires

    Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

    Restrictions
    For Research Use only
  • Format
    Lyophilized
    Reconstitution
    Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
    Concentration
    500 μg/mL
    Buffer
    Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
    Agent conservateur
    Sodium azide
    Précaution d'utilisation
    This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
    Conseil sur la manipulation
    Avoid repeated freezing and thawing.
    Stock
    4 °C/-20 °C
    Stockage commentaire
    At -20°C for one year. After reconstitution, at 4°C for one month.
    It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
  • Antigène
    UBA3 (Ubiquitin-Like Modifier Activating Enzyme 3 (UBA3))
    Autre désignation
    UBA3 (UBA3 Produits)
    Synonymes
    anticorps UBE1C, anticorps hUBA3, anticorps Ube1c, anticorps ube1c, anticorps wu:fb75e04, anticorps wu:fc37b11, anticorps zgc:55528, anticorps A830034N06Rik, anticorps AI256736, anticorps AI848246, anticorps AW546539, anticorps ubiquitin like modifier activating enzyme 3, anticorps ubiquitin-like modifier activating enzyme 3, anticorps ubiquitin like modifier activating enzyme 3 S homeolog, anticorps UBA3, anticorps Uba3, anticorps uba3, anticorps uba3.S
    Sujet
    NEDD8-activating enzyme E1 catalytic subunit is a protein that in humans is encoded by the UBA3 gene. The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the E1 ubiquitin-activating enzyme family. The encoded enzyme associates with AppBp1, an amyloid beta precursor protein binding protein, to form a heterodimer, and then the enzyme complex activates NEDD8, an ubiquitin-like protein, which regulates cell division, signaling and embryogenesis. Multiple alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.

    Synonyms: DKFZp566J164 antibody|EC 6.3.2. antibody|hUba3 antibody|MGC22384 antibody|NEDD8 activating enzyme E1 catalytic subunit antibody|NEDD8 activating enzyme E1C antibody|Nedd8 activating enzyme hUba3 antibody|NEDD8-activating enzyme E1 catalytic subunit antibody|NEDD8-activating enzyme E1C antibody|uba3 antibody|UBA3 ubiquitin activating enzyme E1 homolog antibody|UBA3_HUMAN antibody|UBE1C antibody| Ubiquitin activating enzyme 3 antibody|Ubiquitin activating enzyme E1C antibody|Ubiquitin-activating enzyme 3 antibody|Ubiquitin-activating enzyme E1C antibody|Ubiquitin-like modifier-activating enzyme 3 antibody
    ID gène
    9039
Vous êtes ici:
Support technique