MDM4-binding Protein anticorps (N-Term)

N° du produit ABIN3044527

Détail du produit anti-MDM4-binding Protein anticorps

Antigène: MDM4-binding Protein (MDM4) (Mdm4-binding Protein (MDM4))

Épitope: AA 35-72, N-Term

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp MDM4-binding Protein est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Fonction: Rabbit IgG polyclonal antibody for Protein Mdm4(MDM4) detection. Tested with WB, IHC-P in Human,Mouse.

Séquence: KILHAAGAQG EMFTVKEVMH YLGQYIMVKQ LYDQQEQH

Réactivité croisée (Details): No cross reactivity with other proteins.

Attributs du produit: Rabbit IgG polyclonal antibody for Protein Mdm4(MDM4) detection. Tested with WB, IHC-P in Human,Mouse.
Gene Name: MDM4, p53 regulator
Protein Name: Protein Mdm4

Purification: Immunogen affinity purified.

Immunogène: A synthetic peptide corresponding to a sequence at the N-terminus of human MDMX (35-72aa KILHAAGAQGEMFTVKEVMHYLGQYIMVKQLYDQQEQH), different from the related mouse sequence by two amino acids, and from the related rat sequence by three amino acids.

Isotype: IgG

Information d'application

Indications d'application: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Commentaires:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Conseil sur la manipulation: Avoid repeated freezing and thawing.

Stock: 4 °C/-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Détails sur MDM4-binding Protein

Antigène: MDM4-binding Protein (MDM4) (Mdm4-binding Protein (MDM4))

Autre désignation: MDM4 (MDM4 Produits)

Synonymes: anticorps mdmx, anticorps HDMX, anticorps MDMX, anticorps MRP1, anticorps wu:fa09h09, anticorps wu:fi33d10, anticorps 4933417N07Rik, anticorps AA414968, anticorps AL023055, anticorps AU018793, anticorps AU021806, anticorps C85810, anticorps Mdmx, anticorps MDM4, p53 regulator S homeolog, anticorps MDM4, p53 regulator, anticorps transformed mouse 3T3 cell double minute 4, anticorps mdm4.S, anticorps MDM4, anticorps Mdm4, anticorps mdm4

Sujet: Protein Mdm4 is a protein that in humans is encoded by the MDM4 gene. This gene encodes a nuclear protein that contains a p53 binding domain at the N-terminus and a RING finger domain at the C-terminus, and shows structural similarity to p53-binding protein MDM2. Both proteins bind the p53 tumor suppressor protein and inhibit its activity, and have been shown to be overexpressed in a variety of human cancers. However, unlike MDM2 which degrades p53, this protein inhibits p53 by binding its transcriptional activation domain. This protein also interacts with MDM2 protein via the RING finger domain, and inhibits the latter's degradation. So this protein can reverse MDM2-targeted degradation of p53, while maintaining suppression of p53 transactivation and apoptotic functions. Alternatively spliced transcript variants encoding different isoforms have been noted for this gene.

Synonyms: DKFZp781B1423 antibody|Double minute 4 antibody|Double minute 4 human homolog of p53 binding protein antibody|Double minute 4 protein antibody|HDMX antibody|MDM 4 antibody|Mdm2 like p53 binding protein antibody|Mdm2-like p53-binding protein antibody|MDM4 antibody|Mdm4 p53 binding protein homolog mouse antibody|Mdm4 protein antibody|MDM4 related protein 1 antibody|Mdm4 transformed 3T3 cell double minute 4 antibody|Mdm4 transformed 3T3 cell double minute 4 p53 binding protein antibody|Mdm4 transformed 3T3 cell double minute 4 p53 binding protein mouse antibody|MDM4_HUMAN antibody|Mdmx protein antibody|MGC132766 antibody|Mouse double minute 4 homolog antibody| Mouse double minute 4 human homolog of p53 binding protein antibody|MRP 1 antibody|MRP1 antibody|p53 binding protein antibody|p53 BINDING PROTEIN MDM4 antibody|p53-binding protein Mdm4 antibody|Protein Mdm4 antibody|Protein Mdmx antibody

ID gène: 4194

UniProt: O15151

Pathways: Cycle Cellulaire