Tel:
+49 (0)241 95 163 153
Fax:
+49 (0)241 95 163 155
E-Mail:
orders@anticorps-enligne.fr

DARPP32 anticorps (N-Term)

PPP1R1B Reactivité: Humain, Souris, Rat WB, IHC (p) Hôte: Lapin Polyclonal unconjugated
N° du produit ABIN3044534
  • Antigène Voir toutes DARPP32 (PPP1R1B) Anticorps
    DARPP32 (PPP1R1B) (Protein Phosphatase 1, Regulatory (Inhibitor) Subunit 1B (PPP1R1B))
    Épitope
    • 33
    • 17
    • 15
    • 7
    • 4
    • 4
    • 3
    • 3
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    AA 1-36, N-Term
    Reactivité
    • 94
    • 81
    • 74
    • 12
    • 11
    • 11
    • 7
    • 4
    • 3
    • 3
    • 2
    • 1
    • 1
    • 1
    Humain, Souris, Rat
    Hôte
    • 106
    • 12
    • 1
    • 1
    • 1
    • 1
    Lapin
    Clonalité
    • 101
    • 21
    Polyclonal
    Conjugué
    • 71
    • 6
    • 3
    • 3
    • 3
    • 3
    • 3
    • 3
    • 3
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    Cet anticorp DARPP32 est non-conjugé
    Application
    • 92
    • 38
    • 35
    • 28
    • 27
    • 16
    • 16
    • 8
    • 4
    • 3
    • 3
    • 1
    Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
    Fonction
    Rabbit IgG polyclonal antibody for Protein phosphatase 1 regulatory subunit 1B(PPP1R1B) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
    Séquence
    MDPKDRKKIQ FSVPAPPSQL DPRQVEMIRR RRPTPA
    Réactivité croisée (Details)
    No cross reactivity with other proteins.
    Attributs du produit
    Rabbit IgG polyclonal antibody for Protein phosphatase 1 regulatory subunit 1B(PPP1R1B) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
    Gene Name: protein phosphatase 1 regulatory inhibitor subunit 1B
    Protein Name: Protein phosphatase 1 regulatory subunit 1B
    Purification
    Immunogen affinity purified.
    Immunogène
    A synthetic peptide corresponding to a sequence at the N-terminus of human DARPP32 (1-36aa MDPKDRKKIQFSVPAPPSQLDPRQVEMIRRRRPTPA), identical to the related mouse and rat sequences.
    Isotype
    IgG
    Top Product
    Discover our top product PPP1R1B Anticorps primaire
  • Indications d'application
    WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Rat
    IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Mouse, Rat, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
    Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.
    Commentaires

    Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

    Restrictions
    For Research Use only
  • Format
    Lyophilized
    Reconstitution
    Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
    Concentration
    500 μg/mL
    Buffer
    Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
    Agent conservateur
    Sodium azide
    Précaution d'utilisation
    This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
    Conseil sur la manipulation
    Avoid repeated freezing and thawing.
    Stock
    4 °C/-20 °C
    Stockage commentaire
    At -20°C for one year. After reconstitution, at 4°C for one month.
    It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
  • Antigène
    DARPP32 (PPP1R1B) (Protein Phosphatase 1, Regulatory (Inhibitor) Subunit 1B (PPP1R1B))
    Autre désignation
    PPP1R1B (PPP1R1B Produits)
    Synonymes
    anticorps darpp32, anticorps darpp-32, anticorps Darpp-32, anticorps Darpp32, anticorps DARPP-32, anticorps DARPP32, anticorps AU040756, anticorps protein phosphatase 1 regulatory inhibitor subunit 1B, anticorps protein phosphatase 1, regulatory (inhibitor) subunit 1B, anticorps protein phosphatase 1 regulatory inhibitor subunit 1B S homeolog, anticorps ppp1r1b, anticorps PPP1R1B, anticorps Ppp1r1b, anticorps ppp1r1b.S
    Sujet
    Protein phosphatase 1 regulatory subunit 1B (PPP1R1B), also known as dopamine- and cAMP-regulated neuronal phosphoprotein (DARPP-32), is a protein that in humans is encoded by the PPP1R1B gene. This gene encodes a bifunctional signal transduction molecule. Dopaminergic and glutamatergic receptor stimulation regulates its phosphorylation and function as a kinase or phosphatase inhibitor. As a target for dopamine, this gene may serve as a therapeutic target for neurologic and psychiatric disorders. Multiple transcript variants encoding different isoforms have been found for this gene.

    Synonyms: DARPP 32 antibody|DARPP-32 antibody|Dopamine and cAMP regulated neuronal phosphoprotein 32 antibody|Dopamine and cAMP regulated neuronal phosphoprotein antibody|Dopamine and cAMP regulated phosphoprotein antibody|Dopamine and cAMP regulated phosphoprotein DARPP 32 antibody|Dopamine and cAMP regulated phosphoprotein DARPP32 antibody|Dopamine- and cAMP-regulated neuronal phosphoprotein antibody| FLJ20940 antibody|IPPD antibody|Neuronal phosphoprotein DARPP 32 antibody|PPP1R1B antibody|PPR1B_HUMAN antibody|Protein phosphatase 1 regulatory (inhibitor) subunit 1B antibody|Protein phosphatase 1 regulatory subunit 1B antibody
    ID gène
    84152
Vous êtes ici:
Support technique