SMYD3 anticorps (C-Term)
-
- Antigène Voir toutes SMYD3 Anticorps
- SMYD3 (SET and MYND Domain Containing 3 (SMYD3))
-
Épitope
- AA 388-428, C-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp SMYD3 est non-conjugé
-
Application
- Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
- Fonction
- Rabbit IgG polyclonal antibody for Histone-lysine N-methyltransferase SMYD3(SMYD3) detection. Tested with WB, IHC-P in Human.
- Séquence
- QAMKNLRLAF DIMRVTHGRE HSLIEDLILL LEECDANIRA S
- Réactivité croisée (Details)
- No cross reactivity with other proteins.
- Attributs du produit
-
Rabbit IgG polyclonal antibody for Histone-lysine N-methyltransferase SMYD3(SMYD3) detection. Tested with WB, IHC-P in Human.
Gene Name: SET and MYND domain containing 3
Protein Name: Histone-lysine N-methyltransferase SMYD3 - Purification
- Immunogen affinity purified.
- Immunogène
- A synthetic peptide corresponding to a sequence at the C-terminus of human SMYD3 (388-428aa QAMKNLRLAFDIMRVTHGREHSLIEDLILLLEECDANIRAS), different from the related mouse sequence by one amino acid.
- Isotype
- IgG
- Top Product
- Discover our top product SMYD3 Anticorps primaire
-
-
- Indications d'application
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users. - Commentaires
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Concentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Agent conservateur
- Sodium azide
- Précaution d'utilisation
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Conseil sur la manipulation
- Avoid repeated freezing and thawing.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Antigène
- SMYD3 (SET and MYND Domain Containing 3 (SMYD3))
- Autre désignation
- SMYD3 (SMYD3 Produits)
- Synonymes
- anticorps KMT3E, anticorps ZMYND1, anticorps ZNFN3A1, anticorps bA74P14.1, anticorps 2410008A19Rik, anticorps Zmynd1, anticorps SET and MYND domain containing 3, anticorps SMYD3, anticorps Smyd3
- Sujet
-
SET and MYND domain-containing protein 3 is a protein that in humans is encoded by the SMYD3 gene. The International Radiation Hybrid Mapping Consortium mapped the SMYD3 gene to chromosome 1. This gene encodes a histone methyltransferase which functions in RNA polymerase II complexes by an interaction with a specific RNA helicase. Multiple transcript variants encoding different isoforms have been found for this gene.
Synonyms: bA74P14.1 (novel protein) antibody|bA74P14.1 antibody|FLJ21080 antibody|histone lysine N methyltransferase SMYD3 antibody|KMT3E antibody|MGC104324 antibody|SET and MYND domain containing 3 antibody|SET and MYND domain containing protein 3 antibody|SET and MYND domain-containing protein 3 antibody|SMYD 3 antibody|Smyd3 antibody|SMYD3 protein antibody|SMYD3_HUMAN antibody|Zinc finger MYND domain containing 1 antibody|Zinc finger MYND domain containing protein 1 antibody|Zinc finger MYND domain-containing protein 1 antibody|Zinc finger protein subfamily 3A MYND domain containing 1 antibody|Zinc finger protein, subfamily 3A (MYND domain containing), 1 antibody|ZMYND 1 antibody|ZMYND1 antibody|ZNFN3A1 antibody - ID gène
- 64754
- UniProt
- Q9H7B4
-