YY1 anticorps (Middle Region)
-
- Antigène Voir toutes YY1 Anticorps
- YY1 (YY1 Transcription Factor (YY1))
-
Épitope
- AA 206-241, Middle Region
-
Reactivité
- Humain, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp YY1 est non-conjugé
-
Application
- Western Blotting (WB)
- Fonction
- Rabbit IgG polyclonal antibody for Transcriptional repressor protein YY1(YY1) detection. Tested with WB in Human,Rat.
- Séquence
- EQKQVQIKTL EGEFSVTMWS SDEKKDIDHE TVVEEQ
- Réactivité croisée (Details)
- No cross reactivity with other proteins.
- Attributs du produit
-
Rabbit IgG polyclonal antibody for Transcriptional repressor protein YY1(YY1) detection. Tested with WB in Human,Rat.
Gene Name: YY1 transcription factor
Protein Name: Transcriptional repressor protein YY1 - Purification
- Immunogen affinity purified.
- Immunogène
- A synthetic peptide corresponding to a sequence in the middle region of human YY1 (206-241aa EQKQVQIKTLEGEFSVTMWSSDEKKDIDHETVVEEQ), identical to the related mouse sequence.
- Isotype
- IgG
- Top Product
- Discover our top product YY1 Anticorps primaire
-
-
- Indications d'application
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users. - Commentaires
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB.
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Concentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Agent conservateur
- Sodium azide
- Précaution d'utilisation
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Conseil sur la manipulation
- Avoid repeated freezing and thawing.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Antigène
- YY1 (YY1 Transcription Factor (YY1))
- Autre désignation
- YY1 (YY1 Produits)
- Synonymes
- anticorps yy1-a, anticorps FIII, anticorps MGC83714, anticorps yy1l, anticorps zgc:64207, anticorps YY1, anticorps LOC494431, anticorps xyy1, anticorps delta, anticorps nf-e1, anticorps ucrbp, anticorps yin-yang-1, anticorps LOC100304682, anticorps ino80s, anticorps yy1, anticorps DELTA, anticorps INO80S, anticorps NF-E1, anticorps UCRBP, anticorps YIN-YANG-1, anticorps AW488674, anticorps fb59g10, anticorps wu:fa16g07, anticorps wu:fb59g10, anticorps YY1 transcription factor L homeolog, anticorps YY1 transcription factor b, anticorps YY1 transcription factor, anticorps transcriptional repressor protein YY1, anticorps YY1 transcription factor S homeolog, anticorps YY1 transcription factor a, anticorps YY2 transcription factor, anticorps yy1.L, anticorps yy1b, anticorps YY1, anticorps yy1, anticorps LOC100304682, anticorps yy1.S, anticorps Yy1, anticorps yy1a, anticorps YY2
- Sujet
-
YY1 (Yin Yang 1) is a transcriptional repressor protein in humans that is encoded by the YY1 gene. YY1 is a ubiquitously distributed transcription factor belonging to the GLI-Kruppel class of zinc finger proteins. The protein is involved in repressing and activating a diverse number of promoters. YY1 may direct histone deacetylases and histone acetyltransferases to a promoter in order to activate or repress the promoter, thus implicating histone modification in the function of YY1.
Synonyms: CF1 antibody|Delta antibody|Delta transcription factor antibody|INO80 complex subunit S antibody|INO80S antibody|NF E1 antibody|NF-E1 antibody|NFE1 antibody|OTTHUMP00000197459 antibody|Transcriptional repressor protein YY1 antibody|TYY1_HUMAN antibody|UCR motif DNA binding protein antibody|UCRBP antibody|Yin and yang 1 antibody|Yin and Yang 1 protein antibody|Yin Yang 1 antibody|Ying Yang 1 antibody|YY 1 antibody|YY 1 transcription factor antibody|YY-1 antibody|YY1 antibody|YY1 transcription factor antibody - ID gène
- 7528
- UniProt
- P25490
-