Integrin alpha 3a anticorps

N° du produit ABIN335345

Détail du produit anti-Integrin alpha 3a anticorps

Antigène: Integrin alpha 3a

Reactivité: Humain

Hôte: Souris

Clonalité: Monoclonal

Conjugué: Cet anticorp Integrin alpha 3a est non-conjugé

Application: Immunohistochemistry (IHC), Western Blotting (WB), Immunohistochemistry (Frozen Sections) (IHC (fro)), Immunocytochemistry (ICC)

Specificité: Human. A broad species reactivity is expected because of the conserved nature of the epitope.

Purification: Purified

Immunogène: 29A3 is a mouse monoclonal IgG1, kappa antibody derived by fusion of SP2/0 mouse myeloma cells with spleen cells from a BALB/c mouse immunized with a synthetic peptide corresponding to the cytoplasmic domain of the integrin subunit alpha3A including an additional N-terminal cysteine (CRTRALYEAKRQKAEMKSQPSETERLTDDY) coupled to keyhole limpet hemocyanin.

Clone: 29A3

Isotype: IgG1

Information d'application

Indications d'application: 29A3 recognizes specifically the cytoplasmic domain of integrin subunit alpha3A which is present in the basal cell layer in skin, glomeruli, Bowman€™s capsules and distal tubuli in kidney, all vascular and capillary endothelia in brain, heart and skin, and vascular smooth muscle cells in heart. 29A3 is suitable for immunoblotting, immunocytochemistry and immunohistochemistry on frozen tissues. Optimal antibody dilution should be determined by titration, recommended range is 1:100 - 1:200 for immunohistochemistry with avidin-biotinylated horseradish peroxidase complex (ABC) as detection reagent, and 1:100 - 1:1000 for immunoblotting applications.

Restrictions: For Research Use only

Stockage

Stock: 4 °C

Références pour anticorps anti-Integrin alpha 3a (ABIN335345)

de Melker, Sterk, Delwel, Fles, Daams, Weening, Sonnenberg: "The A and B variants of the alpha 3 integrin subunit: tissue distribution and functional characterization." dans: Laboratory investigation; a journal of technical methods and pathology, Vol. 76, Issue 4, pp. 547-63, (1997) (PubMed).

Delwel, de Melker, Hogervorst, Jaspars, Fles, Kuikman, Lindblom, Paulsson, Timpl, Sonnenberg: "Distinct and overlapping ligand specificities of the alpha 3A beta 1 and alpha 6A beta 1 integrins: recognition of laminin isoforms." dans: Molecular biology of the cell, Vol. 5, Issue 2, pp. 203-15, (1994) (PubMed).

Détails sur Integrin alpha 3a

Antigène: Integrin alpha 3a

Abstract: Integrin alpha 3a Produits

Sujet: Integrins are a family of heterodimeric membrane glycoproteins consisting of non-covalently associated alpha and beta subunits. More than 18 alpha and 8 beta subunits with numerous splice variant isoforms have been identified in mammals. In general, integrins function as receptors for extracellular matrix proteins. Certain integrins can also bind to soluble ligands or to counter-receptors on adjacent cells, such as the intracellular adhesion molecules (ICAMs), resulting in aggregation of cells. Signals transduced by integrins play a role in many biological processes, including cell growth, differentiation, migration and apoptosis. For integrin subunits alpha3 and alpha6, two cytoplasmic variants, A and B, have been identified.