Tel:
+49 (0)241 95 163 153
Fax:
+49 (0)241 95 163 155
E-Mail:
orders@anticorps-enligne.fr

ERK1 anticorps (AA 336-367)

MAPK3 Reactivité: Souris, Rat, Lapin, Hamster WB, IHC, IP Hôte: Lapin Polyclonal unconjugated
N° du produit ABIN351563
  • Antigène Voir toutes ERK1 (MAPK3) Anticorps
    ERK1 (MAPK3) (Mitogen-Activated Protein Kinase 3 (MAPK3))
    Épitope
    • 69
    • 47
    • 20
    • 17
    • 16
    • 15
    • 15
    • 11
    • 11
    • 9
    • 9
    • 8
    • 6
    • 5
    • 5
    • 5
    • 5
    • 3
    • 3
    • 3
    • 3
    • 3
    • 3
    • 2
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    AA 336-367
    Reactivité
    • 222
    • 172
    • 140
    • 45
    • 20
    • 18
    • 17
    • 12
    • 11
    • 10
    • 10
    • 7
    • 7
    • 6
    • 5
    • 3
    • 3
    • 3
    • 1
    • 1
    • 1
    • 1
    Souris, Rat, Lapin, Hamster
    Hôte
    • 230
    • 28
    • 3
    • 1
    • 1
    Lapin
    Clonalité
    • 216
    • 47
    Polyclonal
    Conjugué
    • 101
    • 21
    • 20
    • 17
    • 9
    • 9
    • 5
    • 5
    • 5
    • 5
    • 5
    • 5
    • 5
    • 5
    • 5
    • 5
    • 5
    • 3
    • 3
    • 3
    • 3
    • 3
    • 3
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 1
    Cet anticorp ERK1 est non-conjugé
    Application
    • 212
    • 90
    • 69
    • 68
    • 65
    • 43
    • 38
    • 35
    • 27
    • 20
    • 18
    • 12
    • 12
    • 5
    • 3
    • 2
    • 1
    • 1
    Western Blotting (WB), Immunohistochemistry (IHC), Immunoprecipitation (IP)
    Specificité
    This immunoaffinity purified antibody detects ~42kD and ~44kD bands corresponding to Erk1 and Erk2, respectively. The antibody recognizes Erk1 and Erk2 in samples from human, mouse, rat, bovine, chicken, Drosophila, sheep, Xenopus and mussel. Antibody specificity is confirmed by peptide competition studies.
    Homologie
    Percent identity by BLAST analysis: Marmoset, Mouse, Rat, Hamster, Panda, Rabbit, Opossum (100%) Monkey, Bovine, Dog, Bat, Horse, Platypus (97%) Human, Gorilla, Gibbon, Elephant (94%) Orangutan, Pig, Turkey, Chicken, Pufferfish, Zebrafish (87%) Xenopus (84%).
    Purification
    Protein A purified
    Immunogène
    A 35 residue synthetic peptide, corresponding to a.a. 333-367 {(CGG)PFTFDMELDDLPKERLKELIFQETARFQPGAPEAP}, of rat Erk1 MAP kinase with the CGG spacer group added and the peptide coupled to KLH. Percent identity by BLAST analysis: Marmoset, Mouse, Rat, Hamster, Panda, Rabbit, Opossum (100%), Monkey, Bovine, Dog, Bat, Horse, Platypus (97%), Human, Gorilla, Gibbon, Elephant (94%), Orangutan, Pig, Turkey, Chicken, Pufferfish, Zebrafish (87%), Xenopus (84%).

    Type of Immunogen: Synthetic peptide - KLH conjugated
    Top Product
    Discover our top product MAPK3 Anticorps primaire
  • Indications d'application
    Approved: IHC (10 μg/mL), IP (12.5 μg/mL), WB

    Usage: Western Blot (Colorimetric): 1 μg/mL 1 μg/mL. Western Blot (ECL). Immunoprecipitation: 12.5 μg/mL. Immunohistochemistry: 10 μg/mL. Positive control: Mouse Brain Tissue Extract.
    Commentaires

    Target Species of Antibody: Rat

    Restrictions
    For Research Use only
  • Format
    Liquid
    Concentration
    Lot specific
    Buffer
    Liquid
    Conseil sur la manipulation
    Avoid repeat freeze-thaw cycles.
    Stock
    4 °C,-20 °C
    Stockage commentaire
    Short term: 4°C. Long term: Store at -20°C. Avoid freeze-thaw cycles.
  • Antigène
    ERK1 (MAPK3) (Mitogen-Activated Protein Kinase 3 (MAPK3))
    Autre désignation
    MAPK3 / ERK1 (MAPK3 Produits)
    Synonymes
    anticorps ERK-1, anticorps ERK1, anticorps ERT2, anticorps HS44KDAP, anticorps HUMKER1A, anticorps P44ERK1, anticorps P44MAPK, anticorps PRKM3, anticorps p44-ERK1, anticorps p44-MAPK, anticorps Erk-1, anticorps Erk1, anticorps Ert2, anticorps Esrk1, anticorps Mnk1, anticorps Mtap2k, anticorps Prkm3, anticorps p44, anticorps p44erk1, anticorps p44mapk, anticorps ERK3, anticorps ERK6, anticorps P38GAMMA, anticorps PRKM12, anticorps SAPK-3, anticorps SAPK3, anticorps fi06b09, anticorps wu:fi06b09, anticorps zERK1, anticorps Tb08.10J17.940, anticorps MAPK1, anticorps MNK1, anticorps AW123708, anticorps Erk6, anticorps P38gamma, anticorps Prkm12, anticorps Sapk3, anticorps ATMAPK3, anticorps ATMPK3, anticorps T6D9.4, anticorps mitogen-activated protein kinase 3, anticorps mitogen-activated protein kinase 3, anticorps mitogen-activated protein kinase 12, anticorps mitogen activated protein kinase 3, anticorps mitogen-activated serine/threonine-protein kinase, anticorps MAPK3, anticorps Mapk3, anticorps MAPK12, anticorps mapk3, anticorps Tc00.1047053509475.10, anticorps Tb927.8.3550, anticorps Mapk12, anticorps CEK1, anticorps MPK3
    Sujet
    Name/Gene ID: MAPK3
    Subfamily: MAPK
    Family: Protein Kinase

    Synonyms: MAPK3, ERK-1, ERT2, HUMKER1A, HS44KDAP, MAP kinase 1, MAP kinase isoform p44, MAPK 1, MAPK 3, p44, p44MAPK, p44-MAPK, p44ERK1, Insulin-stimulated MAP2 kinase, MAP kinase 3, p44-ERK1, ERK1, PRKM3
    ID gène
    5595
    UniProt
    P27361
    Pathways
    Signalisation MAPK, Signalisation RTK, Interferon-gamma Pathway, Fc-epsilon Receptor Signaling Pathway, Neurotrophin Signaling Pathway, Response to Growth Hormone Stimulus, Activation of Innate immune Response, Cellular Response to Molecule of Bacterial Origin, Hepatitis C, Protein targeting to Nucleus, Toll-Like Receptors Cascades, Signaling Events mediated by VEGFR1 and VEGFR2, Signaling of Hepatocyte Growth Factor Receptor, VEGFR1 Specific Signals, S100 Proteins
Vous êtes ici:
Support technique