ACO2 anticorps (C-Term)
-
- Antigène Voir toutes ACO2 Anticorps
- ACO2 (Aconitase 2, Mitochondrial (ACO2))
-
Épitope
- AA 561-596, C-Term
-
Reactivité
- Humain, Rat, Souris
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp ACO2 est non-conjugé
-
Application
- Western Blotting (WB)
- Fonction
- Rabbit IgG polyclonal antibody for Aconitate hydratase, mitochondrial(ACO2) detection. Tested with WB in Human,Mouse,Rat.
- Séquence
- TSQRLQLLEP FDKWDGKDLE DLQILIKVKG KCTTDH
- Réactivité croisée (Details)
- No cross reactivity with other proteins.
- Attributs du produit
-
Rabbit IgG polyclonal antibody for Aconitate hydratase, mitochondrial(ACO2) detection. Tested with WB in Human,Mouse,Rat.
Gene Name: aconitase 2
Protein Name: Aconitate hydratase, mitochondrial - Purification
- Immunogen affinity purified.
- Immunogène
- A synthetic peptide corresponding to a sequence at the C-terminus of human Aconitase 2 (561-596aa TSQRLQLLEPFDKWDGKDLEDLQILIKVKGKCTTDH), identical to the related mouse and rat sequences.
- Isotype
- IgG
- Top Product
- Discover our top product ACO2 Anticorps primaire
-
-
- Indications d'application
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users. - Commentaires
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB.
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Concentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Agent conservateur
- Sodium azide
- Précaution d'utilisation
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Conseil sur la manipulation
- Avoid repeated freezing and thawing.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Antigène
- ACO2 (Aconitase 2, Mitochondrial (ACO2))
- Autre désignation
- ACO2 (ACO2 Produits)
- Synonymes
- anticorps DDBDRAFT_0206187, anticorps DDBDRAFT_0230168, anticorps DDB_0206187, anticorps DDB_0230168, anticorps aconitase 2, anticorps F10M23.310, anticorps F10M23_310, anticorps ACONM, anticorps ICRD, anticorps Aco-2, anticorps Aco3, anticorps D10Wsu183e, anticorps cb1017, anticorps wu:fa10e03, anticorps wu:fb69g04, anticorps wu:fc20c11, anticorps aconitase 2, anticorps aconitase 2 S homeolog, anticorps aconitate hydratase, mitochondrial, anticorps aconitase, mitochondrial, anticorps mitochondrial aconitate hydratase, anticorps aconitase 2, mitochondrial, anticorps Probable aconitate hydratase, mitochondrial, anticorps ACO2, anticorps aco2.S, anticorps Bm1_07420, anticorps aco2, anticorps ach1, anticorps Aco2, anticorps aco-2
- Sujet
-
Aconitase 2, mitochondrial is a protein that in humans is encoded by the ACO2 gene. The protein encoded by this gene belongs to the aconitase/IPM isomerase family. It is an enzyme that catalyzes the interconversion of citrate to isocitrate via cis-aconitate in the second step of the TCA cycle. This protein is encoded in the nucleus and functions in the mitochondrion. It was found to be one of the mitochondrial matrix proteins that are preferentially degraded by the serine protease 15(PRSS15), also known as Lon protease, after oxidative modification.
Synonyms: ACO 2 | ACO2 | aconitase 2 | aconitase2 | aconitase-2 | Aconitate hydratase | ACONM | Citrate hydro lyase | ICRD | Q99798 - ID gène
- 50
- UniProt
- Q99798
-