AFF4 anticorps (N-Term)
-
- Antigène Voir toutes AFF4 Anticorps
- AFF4 (AF4/FMR2 Family, Member 4 (AFF4))
-
Épitope
- AA 6-53, N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp AFF4 est non-conjugé
-
Application
- Western Blotting (WB)
- Fonction
- Rabbit IgG polyclonal antibody for AF4/FMR2 family member 4(AFF4) detection. Tested with WB in Human.
- Séquence
- RNVLRMKERE RRNQEIQQGE DAFPPSSPLF AEPYKVTSKE DKLSSRIQ
- Réactivité croisée (Details)
- No cross reactivity with other proteins.
- Attributs du produit
-
Rabbit IgG polyclonal antibody for AF4/FMR2 family member 4(AFF4) detection. Tested with WB in Human.
Gene Name: AF4/FMR2 family member 4
Protein Name: AF4/FMR2 family member 4 - Purification
- Immunogen affinity purified.
- Immunogène
- A synthetic peptide corresponding to a sequence at the N-terminus of human AFF4 (6-53aa RNVLRMKERERRNQEIQQGEDAFPPSSPLFAEPYKVTSKEDKLSSRIQ), identical to the related mouse sequence.
- Isotype
- IgG
- Top Product
- Discover our top product AFF4 Anticorps primaire
-
-
- Indications d'application
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users. - Commentaires
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB.
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Concentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Agent conservateur
- Sodium azide
- Précaution d'utilisation
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Conseil sur la manipulation
- Avoid repeated freezing and thawing.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Antigène
- AFF4 (AF4/FMR2 Family, Member 4 (AFF4))
- Autre désignation
- AFF4 (AFF4 Produits)
- Synonymes
- anticorps AFF4, anticorps RA_m002_jsmFBA6Br, anticorps AF5Q31, anticorps MCEF, anticorps Alf4, anticorps Laf4l, anticorps AF4/FMR2 family member 4 L homeolog, anticorps AF4/FMR2 family member 4, anticorps AF4/FMR2 family, member 4, anticorps aff4.L, anticorps AFF4, anticorps aff4, anticorps Aff4
- Sujet
-
The AFF4 gene encodes a scaffold protein that functions as a core component of the super elongation complex (SEC), which is involved in transcriptional regulation during embryogenesis. The protein encoded by this gene belongs to the AF4 family of transcription factors involved in leukemia. It is a component of the positive transcription elongation factor b (P-TEFb) complex. This gene is mapped to chromosome 5q31.
Synonyms: AF5Q31 | Alf4 | CHOPS | HSPC092 | Laf4 | MCEF | Q9UHB7 - ID gène
- 27125
-