ALDH1B1 anticorps (N-Term)
-
- Antigène Voir toutes ALDH1B1 Anticorps
- ALDH1B1 (Aldehyde Dehydrogenase 1 Family, Member B1 (ALDH1B1))
-
Épitope
- AA 116-156, N-Term
-
Reactivité
- Humain, Rat, Souris
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp ALDH1B1 est non-conjugé
-
Application
- Western Blotting (WB)
- Fonction
- Rabbit IgG polyclonal antibody for Aldehyde dehydrogenase X, mitochondrial(ALDH1B1) detection. Tested with WB in Human,Mouse,Rat.
- Séquence
- RVYLASLETL DNGKPFQESY ALDLDEVIKV YRYFAGWADK
- Réactivité croisée (Details)
- No cross reactivity with other proteins.
- Attributs du produit
-
Rabbit IgG polyclonal antibody for Aldehyde dehydrogenase X, mitochondrial(ALDH1B1) detection. Tested with WB in Human,Mouse,Rat.
Gene Name: aldehyde dehydrogenase 1 family member B1
Protein Name: Aldehyde dehydrogenase X, mitochondrial - Purification
- Immunogen affinity purified.
- Immunogène
- A synthetic peptide corresponding to a sequence at the N-terminus of human ALDH1B1 (116-156aa RVYLASLETLDNGKPFQESYALDLDEVIKVYRYFAGWADK W), different from the related mouse sequence by one amino acid, and from the related rat sequence by two amino acids.
- Isotype
- IgG
- Top Product
- Discover our top product ALDH1B1 Anticorps primaire
-
-
- Indications d'application
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users. - Commentaires
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB.
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Concentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Agent conservateur
- Sodium azide
- Précaution d'utilisation
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Conseil sur la manipulation
- Avoid repeated freezing and thawing.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Antigène
- ALDH1B1 (Aldehyde Dehydrogenase 1 Family, Member B1 (ALDH1B1))
- Autre désignation
- ALDH1B1 (ALDH1B1 Produits)
- Synonymes
- anticorps ALDH5, anticorps ALDHX, anticorps rf2d, anticorps 2700007F14Rik, anticorps aldehyde dehydrogenase 1 family member B1, anticorps aldehyde dehydrogenase 5, anticorps aldehyde dehydrogenase 1 family, member B1, anticorps aldehyde dehydrogenase 3B1, anticorps hypothetical protein, anticorps ALDH1B1, anticorps aldh5, anticorps Aldh1b1, anticorps MCYG_01035, anticorps MGYG_00956, anticorps PGTG_20239
- Sujet
-
Aldehyde dehydrogenase X, mitochondrial is an enzyme that in humans is encoded by the ALDH1B1 gene. This protein belongs to the aldehyde dehydrogenases family of proteins. Aldehyde dehydrogenase is the second enzyme of the major oxidative pathway of alcohol metabolism. This gene does not contain introns in the coding sequence. The variation of this locus may affect the development of alcohol-related problems.
Synonyms: Acetaldehyde dehydrogenase 5 | Aldehyde dehydrogenase X | Aldh1b1 | ALDH5 | ALDHX | P30837 - ID gène
- 219
- UniProt
- P30837
-