ALDH7A1 anticorps (C-Term)
-
- Antigène Voir toutes ALDH7A1 Anticorps
- ALDH7A1 (Aldehyde Dehydrogenase 7 Family, Member A1 (ALDH7A1))
-
Épitope
- AA 333-369, C-Term
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp ALDH7A1 est non-conjugé
-
Application
- Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
- Fonction
- Rabbit IgG polyclonal antibody for Alpha-aminoadipic semialdehyde dehydrogenase(ALDH7A1) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
- Séquence
- ARRLFIHESI HDEVVNRLKK AYAQIRVGNP WDPNVLY
- Réactivité croisée (Details)
- No cross reactivity with other proteins.
- Attributs du produit
-
Rabbit IgG polyclonal antibody for Alpha-aminoadipic semialdehyde dehydrogenase(ALDH7A1) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: aldehyde dehydrogenase 7 family member A1
Protein Name: Alpha-aminoadipic semialdehyde dehydrogenase - Purification
- Immunogen affinity purified.
- Immunogène
- A synthetic peptide corresponding to a sequence at the C-terminus of human ALDH7A1 (333-369aa ARRLFIHESIHDEVVNRLKKAYAQIRVGNPWDPNVLY), different from the related mouse sequence by eight amino acids, and from the related rat sequence by six amino acids.
- Isotype
- IgG
- Top Product
- Discover our top product ALDH7A1 Anticorps primaire
-
-
- Indications d'application
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Rat, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users. - Commentaires
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Concentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Agent conservateur
- Sodium azide
- Précaution d'utilisation
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Conseil sur la manipulation
- Avoid repeated freezing and thawing.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Antigène
- ALDH7A1 (Aldehyde Dehydrogenase 7 Family, Member A1 (ALDH7A1))
- Autre désignation
- ALDH7A1 (ALDH7A1 Produits)
- Synonymes
- anticorps atq1, anticorps ALDH7A1, anticorps ATQ1, anticorps EPD, anticorps PDE, anticorps antiquitin, anticorps ATQ, anticorps wu:fi34d12, anticorps wu:fi35e06, anticorps Atq1, anticorps D18Wsu181e, anticorps aldehyde dehydrogenase 7 family member A1, anticorps aldehyde dehydrogenase 7 family member A1 L homeolog, anticorps aldehyde dehydrogenase 7 family, member A1, anticorps aldehyde dehydrogenase family 7, member A1, anticorps ALDH7A1, anticorps aldh7a1, anticorps aldh7a1.L, anticorps Aldh7a1
- Sujet
-
Aldehyde dehydrogenase 7 family, member A1, also known as ALDH7A1 or antiquitin, is an enzyme that in humans is encoded by the ALDH7A1 gene. The protein encoded by this gene is a member of subfamily 7 in the aldehyde dehydrogenase gene family. These enzymes are thought to play a major role in the detoxification of aldehydes generated by alcohol metabolism andlipid peroxidation. This particular member has homology to a previously described protein from the green garden pea, the 26g pea turgor protein. It is also involved in lysine catabolism that is known to occur in the mitochondrial matrix. Recent reports show that this protein is found both in the cytosol and the mitochondria, and the two forms likely arise from the use of alternative translation initiation sites. An additional variant encoding a different isoform has also been found for this gene. Mutations in this gene are associated with pyridoxine-dependent epilepsy. Several related pseudogenes have also been identified.
Synonyms: ALDH7A1 | Antiquitin 1 | Antiquitin | Antiquitin-1 | ATQ1 | EPD | PDE | P49419 - ID gène
- 501
- UniProt
- P49419
- Pathways
- Sensory Perception of Sound
-