AMHR2 anticorps (C-Term)
-
- Antigène Voir toutes AMHR2 Anticorps
- AMHR2 (Anti-Mullerian Hormone Receptor, Type II (AMHR2))
-
Épitope
- AA 384-419, C-Term
-
Reactivité
- Humain, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp AMHR2 est non-conjugé
-
Application
- Western Blotting (WB)
- Fonction
- Rabbit IgG polyclonal antibody for Anti-Muellerian hormone type-2 receptor(AMHR2) detection. Tested with WB in Human,Rat.
- Séquence
- QRYMAPELLD KTLDLQDWGM ALRRADIYSL ALLLWE
- Réactivité croisée (Details)
- No cross reactivity with other proteins.
- Attributs du produit
-
Rabbit IgG polyclonal antibody for Anti-Muellerian hormone type-2 receptor(AMHR2) detection. Tested with WB in Human,Rat.
Gene Name: anti-Mullerian hormone receptor type 2
Protein Name: Anti-Muellerian hormone type-2 receptor - Purification
- Immunogen affinity purified.
- Immunogène
- A synthetic peptide corresponding to a sequence at the C-terminus of human AMHR2 (384-419aa QRYMAPELLDKTLDLQDWGMALRRADIYSLALLLWE), different from the related mouse and rat sequences by three amino acids.
- Isotype
- IgG
- Top Product
- Discover our top product AMHR2 Anticorps primaire
-
-
- Indications d'application
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users. - Commentaires
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB.
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Concentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Agent conservateur
- Sodium azide
- Précaution d'utilisation
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Conseil sur la manipulation
- Avoid repeated freezing and thawing.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Antigène
- AMHR2 (Anti-Mullerian Hormone Receptor, Type II (AMHR2))
- Autre désignation
- AMHR2 (AMHR2 Produits)
- Synonymes
- anticorps AMHR, anticorps MISR2, anticorps MISRII, anticorps MRII, anticorps Misiir, anticorps Misrii, anticorps Mrii, anticorps anti-Mullerian hormone receptor type 2, anticorps anti-Mullerian hormone type 2 receptor, anticorps AMHR2, anticorps Amhr2
- Classe de substances
- Antibody
- Sujet
-
AMHR2 is the receptor for the anti-Mullerian hormone (AMH) which, in addition to testosterone, results in male sex differentiation. AMH and testosterone are produced in the testes by different cells and have different effects. Testosterone promotes the development of male genitalia while the binding of AMH to the encoded receptor prevents the development of the mullerian ducts into uterus and Fallopian tubes. Mutations in this gene are associated with persistent Mullerian duct syndrome type II. Alternatively spliced transcript variants encoding different isoforms have been identified.
Synonyms: AMH | AMH type II receptor | AMHR | AMHR2 | MIS type II receptor | MISR2 | MISRII | MRII | Q16671 - ID gène
- 269
- UniProt
- Q16671
-