BDKRB2 anticorps (C-Term)

N° du produit ABIN4886484

Détail du produit anti-BDKRB2 anticorps

Antigène: BDKRB2 (Bradykinin Receptor B2 (BDKRB2))

Épitope: AA 357-391, C-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp BDKRB2 est non-conjugé

Application: Western Blotting (WB)

Fonction: Rabbit IgG polyclonal antibody for B2 bradykinin receptor(BDKRB2) detection. Tested with WB in Human.

Séquence: RSEPIQMENS MGTLRTSISV ERQIHKLQDW AGSRQ

Réactivité croisée (Details): No cross reactivity with other proteins.

Attributs du produit: Rabbit IgG polyclonal antibody for B2 bradykinin receptor(BDKRB2) detection. Tested with WB in Human.
Gene Name: bradykinin receptor B2
Protein Name: B2 bradykinin receptor

Purification: Immunogen affinity purified.

Immunogène: A synthetic peptide corresponding to a sequence at the C-terminus of human BDKRB2 (357-391aa RSEPIQMENSMGTLRTSISVERQIHKLQDWAGSRQ), different from the related mouse sequence by five amino acids, and from the related rat sequence by seven amino acids.

Isotype: IgG

Information d'application

Indications d'application: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Commentaires:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Conseil sur la manipulation: Avoid repeated freezing and thawing.

Stock: 4 °C/-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Détails sur BDKRB2

Antigène: BDKRB2 (Bradykinin Receptor B2 (BDKRB2))

Autre désignation: BDKRB2 (BDKRB2 Produits)

Synonymes: anticorps BDKRB2, anticorps b2r, anticorps bk2, anticorps bk-2, anticorps bkr2, anticorps brb2, anticorps kinrec, anticorps B2R, anticorps BK-2, anticorps BK2, anticorps BKR2, anticorps BRB2, anticorps B2BKR, anticorps B2BRA, anticorps B(2), anticorps B2, anticorps BK2R, anticorps Bdkrb2, anticorps bradykinin receptor B2, anticorps bradykinin receptor, beta 2, anticorps bradykinin type 2 receptor, anticorps Bdkrb2, anticorps BDKRB2, anticorps bdkrb2, anticorps kinrec, anticorps B2R

Sujet: Bradykinin receptor B2 is a G-protein coupled receptor forbradykinin, encoded by the BDKRB2 gene in humans. This gene encodes a receptor for bradykinin. The 9 aa bradykinin peptide elicits many responses including vasodilation, edema, smooth muscle spasm and pain fiber stimulation. This receptor associates with G proteins that stimulate a phosphatidylinositol-calcium second messenger system. Alternate start codons result in two isoforms of the protein.

Synonyms: B2 | B2BKR | B2BRA | B2R | BDKR B2 | BDKRB 2 | BDKRB2 | BK 2 | BK 2 receptor | BK R2 | BK-2 receptor | BK2 | BK2 receptor | BK2R | BKR 2 | BKR2 | BR B2 | BRB 2 | BRB2 | Kinin B2 | P30411

ID gène: 624

UniProt: P30411

Pathways: ACE Inhibitor Pathway, Negative Regulation of intrinsic apoptotic Signaling