Caspase 8 anticorps (N-Term)

N° du produit ABIN4886501

Détail du produit anti-Caspase 8 anticorps

Antigène: Caspase 8 (CASP8)

Épitope: AA 410-449, N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Caspase 8 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Fonction: Rabbit IgG polyclonal antibody for Caspase-8(CASP8) detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Séquence: VSYRNPAEGT WYIQSLCQSL RERCPRGDDI LTILTEVNYE

Réactivité croisée (Details): No cross reactivity with other proteins.

Attributs du produit: Rabbit IgG polyclonal antibody for Caspase-8(CASP8) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: caspase 8
Protein Name: Caspase-8

Purification: Immunogen affinity purified.

Immunogène: A synthetic peptide corresponding to a sequence at the N-terminus of human Caspase 8 (410-449aa VSYRNPAEGTWYIQSLCQSLRERCPRGDDILTILTEVNYE), different from the related mouse and rat sequences by seven amino acids.

Isotype: IgG

Information d'application

Indications d'application: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Mouse, Rat, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Commentaires:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Conseil sur la manipulation: Avoid repeated freezing and thawing.

Stock: 4 °C/-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Références pour anticorps anti-Caspase 8 (ABIN4886501)

Guo, Fu, Wang, Wang, Li, Huang, Gao, Li: "Di-2-pyridylhydrazone Dithiocarbamate Butyric Acid Ester Exerted Its Proliferative Inhibition against Gastric Cell via ROS-Mediated Apoptosis and Autophagy." dans: Oxidative medicine and cellular longevity, Vol. 2018, pp. 4950705, (2018) (PubMed).

Zhan, Hu, Yi, An, Huang: "[Corrigendum] Inhibitory activity of apogossypol in human prostate cancer in vitro and in vivo." dans: Molecular medicine reports, Vol. 17, Issue 6, pp. 8010, (2018) (PubMed).

Zhou, He, Wang, Xie, Liu, Liu, Song, Ma: "Intravenous Administration Is an Effective and Safe Route for Cancer Gene Therapy Using the Bifidobacterium-Mediated Recombinant HSV-1 Thymidine Kinase and Ganciclovir." dans: International journal of molecular sciences, Vol. 17, Issue 6, (2017) (PubMed).

Zhou, Hong, Yu, Nie, Gong, Xiong, Xie: "Exopolysaccharides from Lactobacillus plantarum NCU116 induce c-Jun dependent Fas/Fasl-mediated apoptosis via TLR2 in mouse intestinal epithelial cancer cells." dans: Scientific reports, Vol. 7, Issue 1, pp. 14247, (2017) (PubMed).

Zhang, Huang, Wang, Luo, Wang: "2-DG-Regulated RIP and c-FLIP Effect on Liver Cancer Cell Apoptosis Induced by TRAIL." dans: Medical science monitor : international medical journal of experimental and clinical research, Vol. 21, pp. 3442-8, (2016) (PubMed).

Li, Wu, Sun, Zhao, Liu, Zhang: "Croton Tiglium Extract Induces Apoptosis via Bax/Bcl-2 Pathways in Human Lung Cancer A549 Cells" dans: Asian Pacific journal of cancer prevention : APJCP, Vol. 17, Issue 11, pp. 4893-4898, (2016) (PubMed).

Zhan, Hu, Yi, An, Huang: "Inhibitory activity of apogossypol in human prostate cancer in vitro and in vivo." dans: Molecular medicine reports, Vol. 11, Issue 6, pp. 4142-8, (2015) (PubMed).

Lian, Ni, Dai, Su, Smith, Xu, He: "Sorafenib sensitizes (-)-gossypol-induced growth suppression in androgen-independent prostate cancer cells via Mcl-1 inhibition and Bak activation." dans: Molecular cancer therapeutics, Vol. 11, Issue 2, pp. 416-26, (2012) (PubMed).

Zicha, Novotný: "[Relation between the sensitivity of the taste analyzer and high blood pressure]." dans: Vnitr̆ní lékar̆ství, Vol. 32, Issue 7, pp. 642-6, (1986) (PubMed).

Détails sur Caspase 8

Antigène: Caspase 8 (CASP8)

Autre désignation: CASP8 (CASP8 Produits)

Synonymes: anticorps casp8-A, anticorps xCaspase-8, anticorps casp8, anticorps CASP8, anticorps CASP-8, anticorps FLICE, anticorps MACH, anticorps Mch5, anticorps ALPS2B, anticorps CAP4, anticorps Casp-8, anticorps MCH5, anticorps caspase-8, anticorps zgc:92075, anticorps caspase 8 L homeolog, anticorps death related ced-3/Nedd2-like protein, anticorps caspase 8, anticorps caspase-8, anticorps caspase-8-like, anticorps caspase 8, apoptosis-related cysteine peptidase, anticorps casp8.L, anticorps LOC661095, anticorps CASP8, anticorps LOC5563818, anticorps casp8, anticorps LOC100222284, anticorps Casp8

Sujet: CASP8 is also known as CAP4, MACH or MCH5. This gene encodes a member of the cysteine-aspartic acid protease (caspase) family. Sequential activation of caspases plays a central role in the execution-phase of cell apoptosis. Caspases exist as inactive proenzymes composed of a prodomain, a large protease subunit, and a small protease subunit. Activation of caspases requires proteolytic processing at conserved internal aspartic residues to generate a heterodimeric enzyme consisting of the large and small subunits. This protein is involved in the programmed cell death induced by Fas and various apoptotic stimuli. The N-terminal FADD-like death effector domain of this protein suggests that it may interact with Fas-interacting protein FADD. In addtion, this protein was detected in the insoluble fraction of the affected brain region from Huntington disease patients but not in those from normal controls, which implicated the role in neurodegenerative diseases. Many alternatively spliced transcript variants encoding different isoforms have been described, although not all variants have had their full-length sequences determined.

Synonyms: Apoptotic protease Mch 5 | Apoptotic protease Mch5 | Apoptotic protease Mch-5 | CAP 4 | CAP4 | CASP 8 | CASP8 | CASP-8 | Caspase 8 | Caspase8 | Caspase8(CASP8) | Caspase-8(CASP-8) | CED 3 | FADD Like ICE | FADD-like ICE | FLICE | MACH | MCH 5 | MCH5 | Q14790

ID gène: 841

UniProt: Q14790

Pathways: Apoptose, Caspase Cascade in Apoptosis, Signalisation TLR, Activation of Innate immune Response, Tube Formation, Positive Regulation of Endopeptidase Activity, Toll-Like Receptors Cascades