CCDC6 anticorps (N-Term)
-
- Antigène Voir toutes CCDC6 Anticorps
- CCDC6 (Coiled-Coil Domain Containing 6 (CCDC6))
-
Épitope
- AA 156-198, N-Term
-
Reactivité
- Humain, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp CCDC6 est non-conjugé
-
Application
- Western Blotting (WB)
- Fonction
- Rabbit IgG polyclonal antibody for Coiled-coil domain-containing protein 6(CCDC6) detection. Tested with WB in Human,Rat.
- Séquence
- KAELEQHLEQ EQEFQVNKLM KKIKKLENDT ISKQLTLEQL RR
- Réactivité croisée (Details)
- No cross reactivity with other proteins.
- Attributs du produit
-
Rabbit IgG polyclonal antibody for Coiled-coil domain-containing protein 6(CCDC6) detection. Tested with WB in Human,Rat.
Gene Name: coiled-coil domain containing 6
Protein Name: Coiled-coil domain-containing protein 6 - Purification
- Immunogen affinity purified.
- Immunogène
- A synthetic peptide corresponding to a sequence at the N-terminus of human CCDC6 (156-198aa KAELEQHLEQEQEFQVNKLMKKIKKLENDTISKQLTLEQLRR E), identical to the related mouse sequence.
- Isotype
- IgG
- Top Product
- Discover our top product CCDC6 Anticorps primaire
-
-
- Indications d'application
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users. - Commentaires
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB.
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Concentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Agent conservateur
- Sodium azide
- Précaution d'utilisation
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Conseil sur la manipulation
- Avoid repeated freezing and thawing.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Antigène
- CCDC6 (Coiled-Coil Domain Containing 6 (CCDC6))
- Autre désignation
- CCDC6 (CCDC6 Produits)
- Synonymes
- anticorps ccdc6, anticorps fj36e04, anticorps zgc:56563, anticorps zgc:77435, anticorps wu:fj36e04, anticorps MGC53501, anticorps D10S170, anticorps H4, anticorps PTC, anticorps TPC, anticorps TST1, anticorps 2810012H18Rik, anticorps AA536681, anticorps AA960498, anticorps AW061011, anticorps coiled-coil domain containing 6a, anticorps coiled-coil domain containing 6 S homeolog, anticorps coiled-coil domain containing 6, anticorps ccdc6a, anticorps ccdc6.S, anticorps CCDC6, anticorps Ccdc6
- Sujet
-
Coiled-coil domain-containing protein 6 is a protein that in humans is encoded by the CCDC6 gene. This gene encodes a coiled-coil domain-containing protein. The encoded protein is ubiquitously expressed and may function as a tumor suppressor. A chromosomal rearrangement resulting in the expression of a fusion gene containing a portion of this gene and the intracellular kinase-encoding domain of the ret proto-oncogene is the cause of thyroid papillary carcinoma.
Synonyms: CCDC 6 | CCDC6 | D10S170 | H4 | Protein H4 | PTC | TPC | TST1 | TST 1 | Q16204 - ID gène
- 8030
- UniProt
- Q16204
-