Cyclin T1 anticorps (Middle Region)

N° du produit ABIN4886509

Détail du produit anti-Cyclin T1 anticorps

Antigène: Cyclin T1 (CCNT1)

Épitope: AA 375-410, Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Cyclin T1 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Fonction: Rabbit IgG polyclonal antibody for Cyclin-T1(CCNT1) detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Séquence: QKQNSKSVPS AKVSLKEYRA KHAEELAAQK RQLENM

Réactivité croisée (Details): No cross reactivity with other proteins.

Attributs du produit: Rabbit IgG polyclonal antibody for Cyclin-T1(CCNT1) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: cyclin T1
Protein Name: Cyclin-T1

Purification: Immunogen affinity purified.

Immunogène: A synthetic peptide corresponding to a sequence in the middle region of human Cyclin T1 (375-410aa QKQNSKSVPSAKVSLKEYRAKHAEELAAQKRQLENM), different from the related mouse sequence by one amino acid.

Isotype: IgG

Information d'application

Indications d'application: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Mouse, Rat, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Commentaires:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Conseil sur la manipulation: Avoid repeated freezing and thawing.

Stock: 4 °C/-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Détails sur Cyclin T1

Antigène: Cyclin T1 (CCNT1)

Autre désignation: CCNT1 (CCNT1 Produits)

Synonymes: anticorps CG6292, anticorps Dmcyclin T, anticorps Dmel\\CG6292, anticorps ORE-14, anticorps P-TEFb, anticorps anon-74EFc, anticorps dT, anticorps p124, anticorps Cyclin-T1, anticorps ccnt, anticorps cyct1, anticorps CCNT, anticorps CYCT1, anticorps HIVE1, anticorps 2810478G24Rik, anticorps AI115585, anticorps CycT1, anticorps fi75b02, anticorps si:dkey-18f23.10, anticorps wu:fi75b02, anticorps Cyclin T, anticorps cyclin T1, anticorps cyclin T1 L homeolog, anticorps CycT, anticorps CCNT1, anticorps ccnt1, anticorps Ccnt1, anticorps ccnt1.L

Sujet: Cyclin-T1 is a protein that in humans is encoded by the CCNT1 gene. This gene encodes a member of the highly conserved cyclin C subfamily. The encoded protein tightly associates with cyclin-dependent kinase 9, and is a major subunit of positive transcription elongation factor b (p-TEFb). In humans, there are multiple forms of positive transcription elongation factor b, which may include one of several different cyclins along with cyclin-dependent kinase 9. The complex containing the encoded cyclin and cyclin-dependent kinase 9 acts as a cofactor of human immunodeficiency virus type 1 (HIV-1) Tat protein, and is both necessary and sufficient for full activation of viral transcription. This cyclin and its kinase partner are also involved in triggering transcript elongation through phosphorylation of the carboxy-terminal domain of the largest RNA polymerase II subunit. Overexpression of this gene is implicated in tumor growth. Alternative splicing results in multiple transcript variants.

Synonyms: CCN T1 | CCNT | CCNT 1 | CCNT1 | CyclinT | Cyclin T | Cyclin-T | cyclinT1 | cyclin-T1 | cyclin T1 | Cyclin T1b | CYCT 1 | CYCT1 | HIVE1 | O60563

ID gène: 904

UniProt: O60563