CYP17A1 anticorps (C-Term)
-
- Antigène Voir toutes CYP17A1 Anticorps
- CYP17A1 (Cytochrome P450, Family 17, Subfamily A, Polypeptide 1 (CYP17A1))
-
Épitope
- AA 383-419, C-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp CYP17A1 est non-conjugé
-
Application
- Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
- Fonction
- Rabbit IgG polyclonal antibody for Steroid 17-alpha-hydroxylase/17,20 lyase(CYP17A1) detection. Tested with WB, IHC-P in Human.
- Séquence
- EFAVDKGTEV IINLWALHHN EKEWHQPDQF MPERFLN
- Réactivité croisée (Details)
- No cross reactivity with other proteins.
- Attributs du produit
-
Rabbit IgG polyclonal antibody for Steroid 17-alpha-hydroxylase/17,20 lyase(CYP17A1) detection. Tested with WB, IHC-P in Human.
Gene Name: cytochrome P450 family 17 subfamily A member 1
Protein Name: Steroid 17-alpha-hydroxylase/17,20 lyase - Purification
- Immunogen affinity purified.
- Immunogène
- A synthetic peptide corresponding to a sequence at the C-terminus of human CYP17A1 (383-419aa EFAVDKGTEVIINLWALHHNEKEWHQPDQFMPERFLN), different from the related mouse and rat sequences by ten amino acids.
- Isotype
- IgG
- Top Product
- Discover our top product CYP17A1 Anticorps primaire
-
-
- Indications d'application
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users. - Commentaires
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Concentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Agent conservateur
- Sodium azide
- Précaution d'utilisation
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Conseil sur la manipulation
- Avoid repeated freezing and thawing.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Antigène
- CYP17A1 (Cytochrome P450, Family 17, Subfamily A, Polypeptide 1 (CYP17A1))
- Autre désignation
- CYP17A1 (CYP17A1 Produits)
- Synonymes
- anticorps cyp17, anticorps CYPXVII, anticorps P450c17, anticorps cyp17a1, anticorps P450-C17, anticorps wu:fi13g04, anticorps wu:fi17b11, anticorps wu:fi31c08, anticorps zgc:136516, anticorps zgc:66494, anticorps P45017A1, anticorps CYP17, anticorps CPT7, anticorps P450C17, anticorps S17AH, anticorps Cyp17, anticorps p450c17, anticorps cytochrome P450 17A1, anticorps cytochrome P450, family 17, subfamily A, polypeptide 1, anticorps steroidogenic cytochrome P450 17-hydroxylase/lyase, anticorps cytochrome P450 family 17 subfamily A member 1 L homeolog, anticorps cytochrome P450 family 17 subfamily A member 1, anticorps cytochrome P-450 17 alpha-hydroxylase/C17,20-lyase, anticorps cytochrome P450, family 17, subfamily a, polypeptide 1, anticorps cytochrome P450c17, anticorps CpipJ_CPIJ010537, anticorps CpipJ_CPIJ010543, anticorps PTRG_02047, anticorps cyp17a1, anticorps cyp17, anticorps cyp17a1.L, anticorps CYP17A1, anticorps Cyp17a1
- Sujet
-
Cytochrome P450 17A1, also called steroid 17α-monooxygenase, is an enzyme of the hydroxylase type that in humans is encoded by the CYP17A1 gene on chromosome 10. This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum. It has both 17alpha-hydroxylase and 17,20-lyase activities and is a key enzyme in the steroidogenic pathway that produces progestins, mineralocorticoids, glucocorticoids, androgens, and estrogens. Mutations in this gene are associated with isolated steroid-17 alpha-hydroxylase deficiency, 17-alpha-hydroxylase/17,20-lyase deficiency, pseudohermaphroditism, and adrenal hyperplasia.
Synonyms: 20 lyase | CPT7 | CYP17 | CYP17A1 | CYPXVII | P450 C17 | P450c17 | S17AH | P05093 - ID gène
- 1586
- UniProt
- P05093
- Pathways
- Metabolism of Steroid Hormones and Vitamin D, Steroid Hormone Biosynthesis, Regulation of Hormone Metabolic Process, Regulation of Hormone Biosynthetic Process, C21-Steroid Hormone Metabolic Process, Cellular Response to Molecule of Bacterial Origin
-