DHODH anticorps (N-Term)

N° du produit ABIN4886562

Détail du produit anti-DHODH anticorps

Antigène: DHODH (Dihydroorotate Dehydrogenase (DHODH))

Épitope: AA 132-173, N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp DHODH est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Fonction: Rabbit IgG polyclonal antibody for Dihydroorotate dehydrogenase (quinone), mitochondrial(DHODH) detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Séquence: RVFRLPEDQA VINRYGFNSH GLSVVEHRLR ARQQKQAKLT E

Réactivité croisée (Details): No cross reactivity with other proteins.

Attributs du produit: Rabbit IgG polyclonal antibody for Dihydroorotate dehydrogenase (quinone), mitochondrial(DHODH) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: dihydroorotate dehydrogenase (quinone)
Protein Name: Dihydroorotate dehydrogenase (quinone), mitochondrial

Purification: Immunogen affinity purified.

Immunogène: A synthetic peptide corresponding to a sequence at the N-terminus of human DHODH (132-173aa RVFRLPEDQAVINRYGFNSHGLSVVEHRLRARQQKQAKLTE D), different from the related mouse sequence by four amino acids, and from the related rat sequence by two amino acids.

Isotype: IgG

Information d'application

Indications d'application: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Mouse, Rat, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Commentaires:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Conseil sur la manipulation: Avoid repeated freezing and thawing.

Stock: 4 °C/-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Détails sur DHODH

Antigène: DHODH (Dihydroorotate Dehydrogenase (DHODH))

Autre désignation: DHODH (DHODH Produits)

Synonymes: anticorps DHOdehase, anticorps POADS, anticorps URA1, anticorps 2810417D19Rik, anticorps AI834883, anticorps DDBDRAFT_0167009, anticorps DDBDRAFT_0185217, anticorps DDB_0167009, anticorps DDB_0185217, anticorps DHOD, anticorps DHODase, anticorps XFHB_12025, anticorps dhodh, anticorps dihydroorotate dehydrogenase (quinone), anticorps dihydroorotate dehydrogenase, anticorps dihydroorotate dehydrogenase (quinone) L homeolog, anticorps DHODH, anticorps Dhodh, anticorps pyrD, anticorps pyr4, anticorps Mrub_0263, anticorps Arnit_2124, anticorps Trad_2703, anticorps Ftrac_1484, anticorps Ndas_0799, anticorps Mesil_1876, anticorps Slip_0841, anticorps Spirs_1436, anticorps XFHB_RS12780, anticorps dhodh.L

Sujet: Dihydroorotate dehydrogenase (DHODH) is an enzyme that in humans is encoded by the DHODH gene on chromosome 16. The protein encoded by this gene catalyzes the fourth enzymatic step, the ubiquinone-mediated oxidation of dihydroorotate to orotate, in de novo pyrimidine biosynthesis. This protein is a mitochondrial protein located on the outer surface of the inner mitochondrial membrane.

Synonyms: DHOdehase | Dhodh | POADS | URA1 | Q02127

ID gène: 1723

UniProt: Q02127

Pathways: Ribonucleoside Biosynthetic Process, Protein targeting to Nucleus