Emerin anticorps (N-Term)
-
- Antigène Voir toutes Emerin (EMD) Anticorps
- Emerin (EMD)
-
Épitope
- AA 1-48, N-Term
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp Emerin est non-conjugé
-
Application
- Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
- Fonction
- Rabbit IgG polyclonal antibody for Emerin(EMD) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
- Séquence
- MDNYADLSDT ELTTLLRRYN IPHGPVVGST RRLYEKKIFE YETQRRRL
- Réactivité croisée (Details)
- No cross reactivity with other proteins.
- Attributs du produit
-
Rabbit IgG polyclonal antibody for Emerin(EMD) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: emerin
Protein Name: Emerin - Purification
- Immunogen affinity purified.
- Immunogène
- A synthetic peptide corresponding to a sequence at the N-terminus of human Emerin (1-48aa MDNYADLSDTELTTLLRRYNIPHGPVVGSTRRLYEKKIFEYETQRRRL), different from the related mouse sequence by eight amino acids, and from the related rat sequence by nine amino acids.
- Isotype
- IgG
- Top Product
- Discover our top product EMD Anticorps primaire
-
-
- Indications d'application
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users. - Commentaires
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Concentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Agent conservateur
- Sodium azide
- Précaution d'utilisation
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Conseil sur la manipulation
- Avoid repeated freezing and thawing.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Antigène
- Emerin (EMD)
- Autre désignation
- EMD (EMD Produits)
- Synonymes
- anticorps fj58f01, anticorps wu:fj58f01, anticorps EMD, anticorps Bocks, anticorps Bocksbeutel, anticorps CG9424, anticorps Dmel\\CG9424, anticorps emerin, anticorps emd, anticorps xemd1, anticorps xemerin2, anticorps xemd2, anticorps xemerin1, anticorps EDMD, anticorps LEMD5, anticorps STA, anticorps AW550900, anticorps Sta, anticorps emerin, anticorps emerin (Emery-Dreifuss muscular dystrophy), anticorps bocksbeutel, anticorps emerin L homeolog, anticorps emerin S homeolog, anticorps EMD, anticorps emd, anticorps bocks, anticorps emd.L, anticorps emd.S, anticorps Emd
- Sujet
-
Emerin is a serine-rich nuclear membrane protein that in humans is encoded by the EMD gene. And this gene is mapped to Xq28. Emerin is a member of the nuclear lamina-associated protein family. It mediates membrane anchorage to the cytoskeleton. Emery-Dreifuss muscular dystrophy is an X-linked inherited degenerative myopathy resulting from mutation in the EMD (also known clinically as STA) gene. Emerin appears to be involved in mechanotransduction, as emerin-deficient mouse fibroblasts failed to transduce normal mechanosensitive gene expression responses to strain stimuli. In cardiac muscle, emerin is also found complexed to beta-catenin at adherens junctions of intercalated discs, and cardiomyocytes from hearts lacking emerin showed beta-catenin redistribution as well as perturbed intercalated disc architecture and myocyte shape. This interaction appears to be regulated by glycogen synthase kinase 3 beta.
Synonyms: EDMD | Emd | Emerin | LEMD5 | STA | P50402 - ID gène
- 2010
- UniProt
- P50402
-