EPHX2 anticorps (C-Term)
-
- Antigène Voir toutes EPHX2 Anticorps
- EPHX2 (Epoxide Hydrolase 2, Cytoplasmic (EPHX2))
-
Épitope
- AA 505-543, C-Term
-
Reactivité
- Humain, Rat, Souris
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp EPHX2 est non-conjugé
-
Application
- Western Blotting (WB)
- Fonction
- Rabbit IgG polyclonal antibody for Bifunctional epoxide hydrolase 2(EPHX2) detection. Tested with WB in Human,Mouse,Rat.
- Séquence
- QHMEDWIPHL KRGHIEDCGH WTQMDKPTEV NQILIKWLD
- Réactivité croisée (Details)
- No cross reactivity with other proteins.
- Attributs du produit
-
Rabbit IgG polyclonal antibody for Bifunctional epoxide hydrolase 2(EPHX2) detection. Tested with WB in Human,Mouse,Rat.
Gene Name: epoxide hydrolase 2
Protein Name: Bifunctional epoxide hydrolase 2 - Purification
- Immunogen affinity purified.
- Immunogène
- A synthetic peptide corresponding to a sequence at the C-terminus of human EPHX2 (505-543aa QHMEDWIPHLKRGHIEDCGHWTQMDKPTEVNQILIKWLD), different from the related mouse sequence by seven amino acids, and from the related rat sequence by eight amino acids.
- Isotype
- IgG
- Top Product
- Discover our top product EPHX2 Anticorps primaire
-
-
- Indications d'application
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users. - Commentaires
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB.
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Concentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Agent conservateur
- Sodium azide
- Précaution d'utilisation
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Conseil sur la manipulation
- Avoid repeated freezing and thawing.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Antigène
- EPHX2 (Epoxide Hydrolase 2, Cytoplasmic (EPHX2))
- Autre désignation
- EPHX2 (EPHX2 Produits)
- Synonymes
- anticorps CEH, anticorps SEH, anticorps Eph2, anticorps sEP, anticorps epoxide hydrolase 2, anticorps soluble epoxide hydrolase, anticorps Soluble epoxide hydrolase, anticorps alpha/beta hydrolase, anticorps epoxide hydrolase 2, cytoplasmic, anticorps EPHX2, anticorps SEH2, anticorps PTRG_01276, anticorps Deima_0402, anticorps Deipr_0144, anticorps Psed_0418, anticorps Fluta_3767, anticorps HALXA_RS12710, anticorps Ephx2
- Sujet
-
Soluble epoxide hydrolase (sEH) is a bifunctional enzyme that in humans is encoded by the EPHX2 gene. It is mapped to 8p21.2-p21.1. This gene encodes a member of the epoxide hydrolase family. The protein, found in both the cytosol and peroxisomes, binds to specific epoxides and converts them to the corresponding dihydrodiols. Mutations in this gene have been associated with familial hypercholesterolemia. Alternatively spliced transcript variants have been described.
Synonyms: CEH | EPHX2 | SEH | P34913 - ID gène
- 2053
- UniProt
- P34913
-