FABP2 anticorps (N-Term)
-
- Antigène Voir toutes FABP2 Anticorps
- FABP2 (Fatty Acid Binding Protein 2, Intestinal (FABP2))
-
Épitope
- AA 2-38, N-Term
-
Reactivité
- Humain, Rat, Souris
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp FABP2 est non-conjugé
-
Application
- Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
- Fonction
- Rabbit IgG polyclonal antibody for Fatty acid-binding protein, intestinal(FABP2) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
- Séquence
- AFDSTWKVDR SENYDKFMEK MGVNIVKRKL AAHDNLK
- Réactivité croisée (Details)
- No cross reactivity with other proteins.
- Attributs du produit
-
Rabbit IgG polyclonal antibody for Fatty acid-binding protein, intestinal(FABP2) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: fatty acid binding protein 2, intestinal
Protein Name: Fatty acid-binding protein, intestinal - Purification
- Immunogen affinity purified.
- Immunogène
- A synthetic peptide corresponding to a sequence at the N-terminus of human FABP2/I-FABP (2-38aa AFDSTWKVDRSENYDKFMEKMGVNIVKRKLAAHDNLK), different from the related mouse sequence by seven amino acids, and from the related rat sequence by six amino acids.
- Isotype
- IgG
- Top Product
- Discover our top product FABP2 Anticorps primaire
-
-
- Indications d'application
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Mouse, Rat, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users. - Commentaires
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Concentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Agent conservateur
- Sodium azide
- Précaution d'utilisation
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Conseil sur la manipulation
- Avoid repeated freezing and thawing.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Antigène
- FABP2 (Fatty Acid Binding Protein 2, Intestinal (FABP2))
- Autre désignation
- FABP2 (FABP2 Produits)
- Synonymes
- anticorps I-FABP, anticorps ifabp, anticorps zgc:92264, anticorps IFABP, anticorps fabpi, anticorps i-fabp, anticorps fabp2-A, anticorps FABP2, anticorps FABPI, anticorps FABP, anticorps Fabpi, anticorps fabp2, anticorps fabp2a, anticorps fatty acid binding protein 2, intestinal, anticorps fatty acid binding protein 2, anticorps fatty acid binding protein 2 L homeolog, anticorps fabp2, anticorps FABP2, anticorps Fabp2, anticorps fabp2.L
- Sujet
-
FABP 2, Fatty acid-binding protein 2, is a protein that in humans is encoded by the FABP2 gene. Using a human cDNA probe, the gene is assigned to chromosome 4 in somatic cell hybrids. FABP 2 gene contains four exons and is an abundant cytosolic protein in small intestine epithelial cells. The FABPs belong to a multigene family with nearly twenty identified members. And FABPs are divided into at least three distinct types, namely the hepatic-, intestinal- and cardiac-type. They form 14-15 kDa proteins and are thought to participate in the uptake, intracellular metabolism and/or transport of long-chain fatty acids. Also, they may be responsible in the modulation of cell growth and proliferation.
Synonyms: FABP2 | FABPI | I FABP | IFABP | I-FABP | intestinal FABP | P12104 - ID gène
- 2169
- UniProt
- P12104
-