GLA anticorps (C-Term)

N° du produit ABIN4886604

Détail du produit anti-GLA anticorps

Antigène: GLA (Galactosidase, alpha (GLA))

Épitope: AA 218-275, C-Term

Reactivité: Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp GLA est non-conjugé

Application: Western Blotting (WB)

Fonction: Rabbit IgG polyclonal antibody for Alpha-galactosidase A(Gla) detection. Tested with WB in mouse.

Séquence: DIQYYCNHWR NFDDVYDSWE SIKNILSWTV VYQKEIVEVA

Réactivité croisée (Details): No cross reactivity with other proteins.

Attributs du produit: Rabbit IgG polyclonal antibody for Alpha-galactosidase A(Gla) detection. Tested with WB in mouse.
Gene Name: galactosidase, alpha
Protein Name: Alpha-galactosidase A

Purification: Immunogen affinity purified.

Immunogène: A synthetic peptide corresponding to a sequence at the C-terminus of mouse Gla (218-275aa DIQYYCNHWRNFDDVYDSWESIKNILSWTVVYQKEIVEVA), different from the related human sequence by fifteen amino acids.

Isotype: IgG

Information d'application

Indications d'application: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Mouse
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Commentaires:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Conseil sur la manipulation: Avoid repeated freezing and thawing.

Stock: 4 °C/-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Détails sur GLA

Antigène: GLA (Galactosidase, alpha (GLA))

Autre désignation: Gla (GLA Produits)

Synonymes: anticorps GALA, anticorps Ags, anticorps zgc:101584, anticorps MGC130872, anticorps SMU.877, anticorps SCF11.21, anticorps AO090005000217, anticorps alpha-GAL, anticorps galactosidase alpha, anticorps galactosidase, alpha, anticorps galactosidase alpha S homeolog, anticorps alpha-galactosidase, anticorps aga, anticorps alpha-galactosidase A, anticorps GLA, anticorps Gla, anticorps gla, anticorps gla.S, anticorps agaN, anticorps aga, anticorps agaL, anticorps SCO0541, anticorps rafA, anticorps melA, anticorps galA, anticorps ANI_1_2528074, anticorps ANI_1_1502124, anticorps AOR_1_390174, anticorps CpipJ_CPIJ002066, anticorps MCYG_00962, anticorps MCYG_00791, anticorps Tsp_02909, anticorps Tsp_02508

Sujet: Alpha-galactosidase is a glycoside hydrolase enzyme that encoded by the GLA gene. This gene is a homodimeric glycoprotein that hydrolyses the terminal alpha-galactosyl moieties from glycolipids and glycoproteins. This enzyme predominantly hydrolyzes ceramide trihexoside, and it can catalyze the hydrolysis of melibiose into galactose and glucose. A variety of mutations in this gene affect the synthesis, processing, and stability of this enzyme, which causes Fabry disease, a rare lysosomal storage disorder that results from a failure to catabolize alpha-D-galactosyl glycolipid moieties.

Synonyms: Ags | Agalsidase alfa | Alpha D galactosidase A | Alpha gal A | GALA | Galactosidase, alpha | GLA | GLA protein | Melibiase | P06280

ID gène: 11605

UniProt: P51569

Pathways: SARS-CoV-2 Protein Interactome