GPI anticorps (N-Term)
-
- Antigène Voir toutes GPI Anticorps
- GPI (Glucose-6-Phosphate Isomerase (GPI))
-
Épitope
- AA 5-39, N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp GPI est non-conjugé
-
Application
- Western Blotting (WB)
- Fonction
- Rabbit IgG polyclonal antibody for Glucose-6-phosphate isomerase(GPI) detection. Tested with WB in Human.
- Séquence
- TRDPQFQKLQ QWYREHRSEL NLRRLFDANK DRFNH
- Réactivité croisée (Details)
- No cross reactivity with other proteins.
- Attributs du produit
-
Rabbit IgG polyclonal antibody for Glucose-6-phosphate isomerase(GPI) detection. Tested with WB in Human.
Gene Name: glucose-6-phosphate isomerase
Protein Name: Glucose-6-phosphate isomerase - Purification
- Immunogen affinity purified.
- Immunogène
- A synthetic peptide corresponding to a sequence at the N-terminus of human GPI (5-39aa TRDPQFQKLQQWYREHRSELNLRRLFDANKDRFNH), different from the related mouse and rat sequences by sixteen amino acids.
- Isotype
- IgG
- Top Product
- Discover our top product GPI Anticorps primaire
-
-
- Indications d'application
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users. - Commentaires
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB.
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Concentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Agent conservateur
- Sodium azide
- Précaution d'utilisation
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Conseil sur la manipulation
- Avoid repeated freezing and thawing.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Antigène
- GPI (Glucose-6-Phosphate Isomerase (GPI))
- Autre désignation
- GPI (GPI Produits)
- Synonymes
- anticorps PGI, anticorps Amf, anticorps Gpi1, anticorps GPI, anticorps DDBDRAFT_0185620, anticorps DDBDRAFT_0231026, anticorps DDB_0185620, anticorps DDB_0231026, anticorps CG8251, anticorps Dmel\\CG8251, anticorps Gpi, anticorps pgi, anticorps Gpi-1, anticorps Gpi-1r, anticorps Gpi-1s, anticorps Gpi-1t, anticorps Gpi1-r, anticorps Gpi1-s, anticorps Gpi1-t, anticorps Gpi1s, anticorps MF, anticorps NK, anticorps NK/GPI, anticorps Org, anticorps AMF, anticorps GNPI, anticorps NLK, anticorps PHI, anticorps SA-36, anticorps SA36, anticorps gpi, anticorps pgi-2, anticorps glucose-6-phosphate isomerase, anticorps gpi, anticorps glucose-6-phosphate isomerase 1, anticorps gpi Glucose-6-phosphate isomerase, anticorps Phosphoglucose isomerase, anticorps glucose phosphate isomerase 1, anticorps glucose-6-phosphate isomerase b, anticorps GPI, anticorps Gpi, anticorps gpi, anticorps pgi, anticorps GPI1, anticorps Pgi, anticorps Gpi1, anticorps gpib
- Classe de substances
- Viral Protein
- Sujet
-
Glucose-6-phosphate isomerase (GPI), alternatively known as phosphoglucose isomerase (PGI) or phosphohexose isomerase(PHI), is an enzyme that in humans is encoded by the GPI gene on chromosome 19. This gene encodes a member of the glucose phosphate isomerase protein family. The encoded protein has been identified as a moonlighting protein based on its ability to perform mechanistically distinct functions. In the cytoplasm, the gene product functions as a glycolytic enzyme (glucose-6-phosphate isomerase) that interconverts glucose-6-phophsate and fructose-6-phosphate. Extracellularly, the encoded protein (also referred to as neuroleukin) functions as a neurotrophic factor that promotes survival of skeletal motor neurons and sensory neurons, and as a lymphokine that induces immunoglobulin secretion. The encoded protein is also referred to as autocrine motility factor based on an additional function as a tumor-secreted cytokine and angiogenic factor. Defects in this gene are the cause of nonspherocytic hemolytic anemia and a severe enzyme deficiency can be associated with hydrops fetalis, immediate neonatal death and neurological impairment. Alternative splicing results in multiple transcript variants.
Synonyms: AMF | Aurocrine motility factor | GNPI | GPI | Gpi1 | Neuroleukin | NLK | Oxoisomerase | PGI | PHI | SA36 | SA-36 | SA 36 | P06744 - ID gène
- 2821
- UniProt
- P06744
-