HDGF anticorps (C-Term)

N° du produit ABIN4886613

Détail du produit anti-HDGF anticorps

Antigène: HDGF (Hepatoma-Derived Growth Factor (HDGF))

Épitope: AA 61-97, C-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp HDGF est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Fonction: Rabbit IgG polyclonal antibody for Hepatoma-derived growth factor(HDGF) detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Séquence: KDLFPYEESK EKFGKPNKRK GFSEGLWEIE NNPTVKA

Réactivité croisée (Details): No cross reactivity with other proteins.

Attributs du produit: Rabbit IgG polyclonal antibody for Hepatoma-derived growth factor(HDGF) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: hepatoma-derived growth factor
Protein Name: Hepatoma-derived growth factor

Purification: Immunogen affinity purified.

Immunogène: A synthetic peptide corresponding to a sequence at the C-terminus of human HDGF (61-97aa KDLFPYEESKEKFGKPNKRKGFSEGLWEIENNPTVKA), identical to the related mouse and rat sequences.

Isotype: IgG

Information d'application

Indications d'application: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Rat
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Mouse, Rat, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Commentaires:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Conseil sur la manipulation: Avoid repeated freezing and thawing.

Stock: 4 °C/-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Détails sur HDGF

Antigène: HDGF (Hepatoma-Derived Growth Factor (HDGF))

Autre désignation: HDGF (HDGF Produits)

Synonymes: anticorps HMG1L2, anticorps hmg1l2, anticorps HDGF, anticorps DKFZp459H185, anticorps AI118077, anticorps D3Ertd299e, anticorps heparin binding growth factor, anticorps hepatoma-derived growth factor, anticorps hepatoma-derived growth factor (high-mobility group protein 1-like), anticorps heparin binding growth factor L homeolog, anticorps hepatoma-derived growth factor-like, anticorps HDGF, anticorps hdgf, anticorps Hdgf, anticorps hdgf.L, anticorps LOC100357981

Sujet: Hepatoma-derived growth factor (HDGF), also known as high mobility group protein 1-like 2 (HMG-1L2), is a protein that in humans is encoded by the HDGF gene. This gene encodes a member of the hepatoma-derived growth factor family. The encoded protein has mitogenic and DNA-binding activity and may play a role in cellular proliferation and differentiation. High levels of expression of this gene enhance the growth of many tumors. And this gene was thought initially to be located on chromosome X, however, that location has been determined to correspond to a related pseudogene. Alternatively spliced transcript variants encoding distinct isoforms have been described.

Synonyms: HDGF | HMG-1L2 | HMG1L2 | P51858

ID gène: 3068

UniProt: P51858

Pathways: ER-Nucleus Signaling