HMGB2 anticorps (N-Term)

N° du produit ABIN4886620

Détail du produit anti-HMGB2 anticorps

Antigène: HMGB2 (High Mobility Group Box 2 (HMGB2))

Épitope: AA 65-97, N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp HMGB2 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Fonction: Rabbit IgG polyclonal antibody for High mobility group protein B2(HMGB2) detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Séquence: KSDKARYDRE MKNYVPPKGD KKGKKKDPNA PKR

Réactivité croisée (Details): No cross reactivity with other proteins.

Attributs du produit: Rabbit IgG polyclonal antibody for High mobility group protein B2(HMGB2) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: high mobility group box 2
Protein Name: High mobility group protein B2

Purification: Immunogen affinity purified.

Immunogène: A synthetic peptide corresponding to a sequence at the N-terminus of human HMGB2 (65-97aa KSDKARYDREMKNYVPPKGDKKGKKKDPNAPKR), identical to the related mouse and rat sequences.

Isotype: IgG

Information d'application

Indications d'application: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Rat
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Mouse, Rat, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Commentaires:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Conseil sur la manipulation: Avoid repeated freezing and thawing.

Stock: 4 °C/-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Détails sur HMGB2

Antigène: HMGB2 (High Mobility Group Box 2 (HMGB2))

Autre désignation: HMGB2 (HMGB2 Produits)

Synonymes: anticorps HMG2, anticorps C80539, anticorps HMG-2, anticorps Hmg2, anticorps HIGH MOBILITY GROUP BETA 1, anticorps HMG BETA 1, anticorps NFD02, anticorps NFD2, anticorps NUCLEOSOME/CHROMATIN ASSEMBLY FACTOR GROUP D 02, anticorps NUCLEOSOME/CHROMATIN ASSEMBLY FACTOR GROUP D 2, anticorps high mobility group B2, anticorps hmgb2, anticorps hmgb2l, anticorps im:6909096, anticorps wu:fa20b02, anticorps zgc:101854, anticorps wu:fb22b10, anticorps wu:fc95d12, anticorps zgc:123215, anticorps high mobility group box 2, anticorps high mobility group box 2 S homeolog, anticorps high mobility group B2, anticorps high mobility group box 2b, anticorps high mobility group box 2a, anticorps HMGB2, anticorps Hmgb2, anticorps hmgb2.S, anticorps hmgb2b, anticorps hmgb2a

Sujet: High-mobility group protein B2, also known as high-mobility group protein 2 (HMG-2), is a protein that in humans is encoded by the HMGB2 gene. This gene encodes a member of the non-histone chromosomal high mobility group protein family. The proteins of this family are chromatin-associated and ubiquitously distributed in the nucleus of higher eukaryotic cells. In vitro studies have demonstrated that this protein is able to efficiently bend DNA and form DNA circles. These studies suggest a role in facilitating cooperative interactions between cis-acting proteins by promoting DNA flexibility. This protein was also reported to be involved in the final ligation step in DNA end-joining processes of DNA double-strand breaks repair and V(D)J recombination.

Synonyms: C80539 | HMG2 | HMG-2 | HMG 2 | HMG B2 | HMGB2 | P26583

ID gène: 3148

UniProt: P26583

Pathways: Cellular Response to Molecule of Bacterial Origin