HNRNPA1 anticorps (N-Term)

N° du produit ABIN4886621

Détail du produit anti-HNRNPA1 anticorps

Antigène: HNRNPA1 (Heterogeneous Nuclear Ribonucleoprotein A1 (HNRNPA1))

Épitope: AA 8-42, N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp HNRNPA1 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Fonction: Rabbit IgG polyclonal antibody for Heterogeneous nuclear ribonucleoprotein A1(HNRNPA1) detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Séquence: KEPEQLRKLF IGGLSFETTD ESLRSHFEQW GTLTD

Réactivité croisée (Details): No cross reactivity with other proteins.

Attributs du produit: Rabbit IgG polyclonal antibody for Heterogeneous nuclear ribonucleoprotein A1(HNRNPA1) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: heterogeneous nuclear ribonucleoprotein A1
Protein Name: Heterogeneous nuclear ribonucleoprotein A1

Purification: Immunogen affinity purified.

Immunogène: A synthetic peptide corresponding to a sequence at the N-terminus of human HnRNP A1 (8-42aa KEPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTD), identical to the related mouse and rat sequences.

Isotype: IgG

Information d'application

Indications d'application: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Mouse, Rat, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Commentaires:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Conseil sur la manipulation: Avoid repeated freezing and thawing.

Stock: 4 °C/-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Détails sur HNRNPA1

Antigène: HNRNPA1 (Heterogeneous Nuclear Ribonucleoprotein A1 (HNRNPA1))

Autre désignation: HNRNPA1 (HNRNPA1 Produits)

Synonymes: anticorps HNRPA1, anticorps HNRPA1L3, anticorps hnRNP A1, anticorps hnRNP-A1, anticorps hnrpa1, anticorps TPT1P, anticorps HNRNPA1, anticorps D15Ertd119e, anticorps Hdp, anticorps Hnrpa1, anticorps hnrnp-A1, anticorps ROA1, anticorps zgc:66127, anticorps heterogeneous nuclear ribonucleoprotein A1, anticorps heterogeneous nuclear ribonucleoprotein A1b, anticorps Heterogeneous nuclear ribonucleoprotein A1, anticorps heterogeneous nuclear ribonucleoprotein A1 S homeolog, anticorps ribonucleoprotein A1a, anticorps heterogeneous nuclear ribonucleoprotein A1-like, anticorps heterogeneous nuclear ribonucleoprotein A1a, anticorps HNRNPA1, anticorps hnrnpa1b, anticorps LOC100101226, anticorps roa1, anticorps Hnrnpa1, anticorps hnrnpa1.S, anticorps hnrnpa1, anticorps LOC100359118, anticorps hnrnpa1a

Sujet: Heterogeneous nuclear ribonucleoprotein A1 is a protein that in humans is encoded by the HNRNPA1 gene. This gene encodes a member of a family of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs), which are RNA-binding proteins that associate with pre-mRNAs in the nucleus and influence pre-mRNA processing, as well as other aspects of mRNA metabolism and transport. The protein encoded by this gene is one of the most abundant core proteins of hnRNP complexes and plays a key role in the regulation of alternative splicing. Mutations in this gene have been observed in individuals with amyotrophic lateral sclerosis 20. Multiple alternatively spliced transcript variants have been found. There are numerous pseudogenes of this gene distributed throughout the genome.

Synonyms: ALS19 | ALS20 | HNRNPA 1 | HNRNPA1 | hnRNP A1 | HNRPA1 | UP 1 | IBMPFD3 | HNRPA1L3 | P09651

ID gène: 3178

UniProt: P09651