ITLN1/Omentin anticorps (N-Term)

N° du produit ABIN4886644

Détail du produit anti-ITLN1/Omentin anticorps

Antigène: ITLN1/Omentin (ITLN1) (Intelectin 1 (Galactofuranose Binding) (ITLN1))

Épitope: AA 19-59, N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ITLN1/Omentin est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Fonction: Rabbit IgG polyclonal antibody for Intelectin-1(ITLN1) detection. Tested with WB, IHC-P in Human.

Séquence: TDEANTYFKE WTCSSSPSLP RSCKEIKDEC PSAFDGLYFL R

Réactivité croisée (Details): No cross reactivity with other proteins.

Attributs du produit: Rabbit IgG polyclonal antibody for Intelectin-1(ITLN1) detection. Tested with WB, IHC-P in Human.
Gene Name: intelectin 1
Protein Name: Intelectin-1

Purification: Immunogen affinity purified.

Immunogène: A synthetic peptide corresponding to a sequence at the N-terminus of human ITLN1 (19-59aa TDEANTYFKEWTCSSSPSLPRSCKEIKDECPSAFDGLYFLR).

Isotype: IgG

Information d'application

Indications d'application: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Commentaires:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Conseil sur la manipulation: Avoid repeated freezing and thawing.

Stock: 4 °C/-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Détails sur ITLN1/Omentin

Antigène: ITLN1/Omentin (ITLN1) (Intelectin 1 (Galactofuranose Binding) (ITLN1))

Autre désignation: ITLN1 (ITLN1 Produits)

Synonymes: anticorps IntL, anticorps Itln, anticorps Itln2, anticorps Itln5, anticorps Itlna, anticorps Lfr, anticorps HL-1, anticorps HL1, anticorps INTL, anticorps ITLN, anticorps LFR, anticorps hIntL, anticorps omentin, anticorps LfR, anticorps Xeel, anticorps hl-1, anticorps hl1, anticorps intl, anticorps itln, anticorps itln1, anticorps lfr, anticorps xeel, anticorps INTL1, anticorps zgc:153267, anticorps intelectin 1 (galactofuranose binding), anticorps intelectin 1, anticorps intelectin 1 L homeolog, anticorps Itln1, anticorps ITLN1, anticorps itln1.L, anticorps itln1

Sujet: Intelectin-1, also known as omentin, is an intelectin encoded in humans by the ITLN1 gene. This gene is mapped to chromosome 1q21.3-q22 by genomic sequence analysis. It is expressed on multiple cell types and appears to participate in insulin signaling and microbe recognition. Intelectin-1 functions both as a receptor for bacterial arabinogalactans and for lactoferrin. Having conserved ligand binding site residues, both human and mouse intelectin-1 bind the exocyclic vicinal diol of carbohydrate ligands such as galactofuranose.

Synonyms: Endothelial lectin HL 1 | Endothelial lectin HL-1 | hIntL | HL1 | HL 1 | Intelectin | Intelectin-1 | Intelectin 1 | INTL | ITLN | ITLN-1 | ITLN1 | LFR | Omentin | Q8WWA0

ID gène: 55600