Cytokeratin 5 anticorps (Middle Region)
-
- Antigène Voir toutes Cytokeratin 5 (KRT5) Anticorps
- Cytokeratin 5 (KRT5) (Keratin 5 (KRT5))
-
Épitope
- AA 286-317, Middle Region
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp Cytokeratin 5 est non-conjugé
-
Application
- Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
- Fonction
- Rabbit IgG polyclonal antibody for Keratin, type II cytoskeletal 5(KRT5) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
- Séquence
- KVELEAKVDA LMDEINFMKM FFDAELSQMQ TH
- Réactivité croisée (Details)
- No cross reactivity with other proteins.
- Attributs du produit
-
Rabbit IgG polyclonal antibody for Keratin, type II cytoskeletal 5(KRT5) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: keratin 5
Protein Name: Keratin, type II cytoskeletal 5 - Purification
- Immunogen affinity purified.
- Immunogène
- A synthetic peptide corresponding to a sequence in the middle region of human Cytokeratin 5 (286-317aa KVELEAKVDALMDEINFMKMFFDAELSQMQTH), different from the related mouse sequence by one amino acid, and identical to the related rat sequence.
- Isotype
- IgG
- Top Product
- Discover our top product KRT5 Anticorps primaire
-
-
- Indications d'application
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Mouse, Rat, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users. - Commentaires
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Concentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Agent conservateur
- Sodium azide
- Précaution d'utilisation
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Conseil sur la manipulation
- Avoid repeated freezing and thawing.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Antigène
- Cytokeratin 5 (KRT5) (Keratin 5 (KRT5))
- Autre désignation
- KRT5 (KRT5 Produits)
- Synonymes
- anticorps 3300001P10Rik, anticorps AW146334, anticorps CK5, anticorps K5, anticorps Krt2-5, anticorps Tfip8, anticorps DDD, anticorps DDD1, anticorps EBS2, anticorps KRT5A, anticorps Sak57, anticorps ckii, anticorps wu:fb02h09, anticorps wu:fj02d02, anticorps wu:fk78b12, anticorps zfCKII, anticorps KRT75, anticorps CK-5, anticorps Keratin-5, anticorps keratin 5, anticorps Krt5, anticorps KRT5, anticorps krt5
- Sujet
-
Cytokeratin 5, also known as KRT5, K5, or CK5, is a protein that is encoded in humans by the KRT5 gene. The protein encoded by this gene is a member of the keratin gene family. The type II cytokeratins consist of basic or neutral proteins which are arranged in pairs of heterotypic keratin chains coexpressed during differentiation of simple and stratified epithelial tissues. This type II cytokeratin is specifically expressed in the basal layer of the epidermis with family member KRT14. Mutations in these genes have been associated with a complex of diseases termed epidermolysis bullosa simplex. The type II cytokeratins are clustered in a region of chromosome 12q12-q13.
Synonyms: CK-5 | CK5 | Cytokeratin-5 | Cytokeratin5 | DDD | DDD1 | EBS2 | K5 | Keratin 5 | Keratin | Keratin-5 | Keratin5 | KRT 5 | Krt5 | KRT5A | P13647 - ID gène
- 3852
- UniProt
- P13647
-