GAL4 anticorps (C-Term)
-
- Antigène Voir toutes GAL4 (LGALS4) Anticorps
- GAL4 (LGALS4) (Galectin 4 (LGALS4))
-
Épitope
- AA 283-320, C-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp GAL4 est non-conjugé
-
Application
- Western Blotting (WB)
- Fonction
- Rabbit IgG polyclonal antibody for Galectin-4(LGALS4) detection. Tested with WB in Human.
- Séquence
- DRFKVYANGQ HLFDFAHRLS AFQRVDTLEI QGDVTLSY
- Réactivité croisée (Details)
- No cross reactivity with other proteins.
- Attributs du produit
-
Rabbit IgG polyclonal antibody for Galectin-4(LGALS4) detection. Tested with WB in Human.
Gene Name: lectin, galactoside binding soluble 4
Protein Name: Galectin-4 - Purification
- Immunogen affinity purified.
- Immunogène
- A synthetic peptide corresponding to a sequence at the C-terminus of human GAL4 (283-320aa DRFKVYANGQHLFDFAHRLSAFQRVDTLEIQGDVTLSY), different from the related mouse and rat sequences by seven amino acids.
- Isotype
- IgG
- Top Product
- Discover our top product LGALS4 Anticorps primaire
-
-
- Indications d'application
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users. - Commentaires
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB.
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Concentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Agent conservateur
- Sodium azide
- Précaution d'utilisation
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Conseil sur la manipulation
- Avoid repeated freezing and thawing.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Antigène
- GAL4 (LGALS4) (Galectin 4 (LGALS4))
- Autre désignation
- LGALS4 (LGALS4 Produits)
- Synonymes
- anticorps LGALS4, anticorps gal4, anticorps l36lbp, anticorps MGC86186, anticorps galectin-4, anticorps xgalectin-VIa, anticorps gal-4, anticorps L36LBP, anticorps L-36, anticorps L36LBI, anticorps GAL4, anticorps galectin 4, anticorps lectin, galactoside-binding, soluble, 4 L homeolog, anticorps Galectin-4, anticorps lectin, galactose binding, soluble 4, anticorps LGALS4, anticorps lgals4.L, anticorps leg4, anticorps Lgals4
- Sujet
-
Galectin-4 is a protein that in humans is encoded by the LGALS4 gene. This gene is mapped to chromosome 19q13.2 based on an alignment of the LGALS4 sequence. The galectins are a family of beta-galactoside-binding proteins implicated in modulating cell-cell and cell-matrix interactions. LGALS4 is an S-type lectin that is strongly underexpressed in colorectal cancer. The 323-amino acid LGALS4 protein contains 2 homologous, approximately 150-amino acid carbohydrate recognition domains and all amino acids typically conserved in galectins.
Synonyms: Antigen NY CO 27 | Antigen NY-CO-27 | Antigen NYCO27 | GAL 4 | Gal-4 | GAL4 | Galectin 4 | Galectin-4 | Galectin -4 | L36LBP | LGALS4 | P56470 - ID gène
- 3960
- UniProt
- P56470
-