LRIG3 anticorps (Middle Region)
-
- Antigène Voir toutes LRIG3 Anticorps
- LRIG3 (Leucine-Rich Repeats and Immunoglobulin-Like Domains 3 (LRIG3))
-
Épitope
- AA 428-465, Middle Region
- Reactivité
- Humain, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp LRIG3 est non-conjugé
-
Application
- Western Blotting (WB)
- Fonction
- Rabbit IgG polyclonal antibody for Leucine-rich repeats and immunoglobulin-like domains protein 3(LRIG3) detection. Tested with WB in Human,Rat.
- Séquence
- NAFSQMKKLQ QLHLNTSSLL CDCQLKWLPQ WVAENNFQ
- Réactivité croisée (Details)
- No cross reactivity with other proteins.
- Attributs du produit
-
Rabbit IgG polyclonal antibody for Leucine-rich repeats and immunoglobulin-like domains protein 3(LRIG3) detection. Tested with WB in Human,Rat.
Gene Name: leucine rich repeats and immunoglobulin like domains 3
Protein Name: Leucine-rich repeats and immunoglobulin-like domains protein 3 - Purification
- Immunogen affinity purified.
- Immunogène
- A synthetic peptide corresponding to a sequence in the middle region of human LRIG3 (428-465aa NAFSQMKKLQQLHLNTSSLLCDCQLKWLPQWVAENNFQ), different from the related mouse sequence by one amino acid.
- Isotype
- IgG
- Top Product
- Discover our top product LRIG3 Anticorps primaire
-
-
- Indications d'application
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users. - Commentaires
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB.
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Concentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Agent conservateur
- Sodium azide
- Précaution d'utilisation
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Conseil sur la manipulation
- Avoid repeated freezing and thawing.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Antigène
- LRIG3 (Leucine-Rich Repeats and Immunoglobulin-Like Domains 3 (LRIG3))
- Autre désignation
- LRIG3 (LRIG3 Produits)
- Synonymes
- anticorps LRIG3, anticorps lrig3, anticorps GB17149, anticorps LIG3, anticorps 9030421L11Rik, anticorps 9130004I02Rik, anticorps 9430095K15Rik, anticorps mKIAA3016, anticorps RGD1561255, anticorps leucine rich repeats and immunoglobulin like domains 3, anticorps leucine-rich repeats and immunoglobulin-like domains 3, anticorps leucine-rich repeats and immunoglobulin-like domains protein 3, anticorps leucine-rich repeats and immunoglobulin like domains 3 S homeolog, anticorps leucine-rich repeats and immunoglobulin like domains 3, anticorps LRIG3, anticorps lrig3, anticorps LOC726128, anticorps lrig3.S, anticorps Lrig3
- Sujet
-
LRIG3 (leucine-rich repeats and Ig-like domains-3) is a 140 kDa type I transmembrane glycoprotein member of the mammalian LRIG glycoprotein family. It shares 46.8 % and 54.0 % amino acid identity with LRIG1 and LRIG2, respectively, with highest conservation in the extracellular, transmembrane, and membrane-proximal sequences. This gene is mapped to chromosome 12q13.2. LRIG3 may play a role in craniofacial and inner ear morphogenesis during embryonic development. It also may act within the otic vesicle epithelium to control formation of the lateral semicircular canal in the inner ear, possibly by restricting the expression of NTN1.
Synonyms: LIG-3 | LIG3 | LRIG1-3 | Lrig3 | Q6UXM1 - ID gène
- 121227
-