Tel:
+49 (0)241 95 163 153
Fax:
+49 (0)241 95 163 155
E-Mail:
orders@anticorps-enligne.fr

MMP13 anticorps (N-Term)

MMP13 Reactivité: Humain WB Hôte: Lapin Polyclonal unconjugated
N° du produit ABIN4886667
  • Antigène Voir toutes MMP13 Anticorps
    MMP13 (Matrix Metallopeptidase 13 (Collagenase 3) (MMP13))
    Épitope
    • 15
    • 15
    • 8
    • 8
    • 7
    • 7
    • 6
    • 6
    • 6
    • 6
    • 5
    • 4
    • 3
    • 3
    • 3
    • 3
    • 2
    • 2
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    AA 109-154, N-Term
    Reactivité
    • 114
    • 51
    • 36
    • 18
    • 10
    • 3
    • 3
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    Humain
    Hôte
    • 121
    • 13
    • 7
    Lapin
    Clonalité
    • 123
    • 18
    Polyclonal
    Conjugué
    • 60
    • 20
    • 13
    • 7
    • 4
    • 3
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    Cet anticorp MMP13 est non-conjugé
    Application
    • 114
    • 59
    • 46
    • 27
    • 26
    • 26
    • 21
    • 16
    • 15
    • 9
    • 8
    • 3
    • 1
    • 1
    • 1
    Western Blotting (WB)
    Fonction
    Rabbit IgG polyclonal antibody for Collagenase 3 (MMP13) detection. Tested with WB in Human.
    Séquence
    RTLKWSKMNL TYRIVNYTPD MTHSEVEKAF KKAFKVWSDV TPLNFT
    Réactivité croisée (Details)
    No cross reactivity with other proteins.
    Attributs du produit
    Rabbit IgG polyclonal antibody for Collagenase 3 (MMP13) detection. Tested with WB in Human.
    Gene Name: matrix metallopeptidase 13
    Protein Name: Collagenase 3
    Purification
    Immunogen affinity purified.
    Immunogène
    A synthetic peptide corresponding to a sequence at the N-terminus of human MMP13 (109-154aa RTLKWSKMNLTYRIVNYTPDMTHSEVEKAFKKAFKVWSDVTPLNFT), different from the related mouse sequence by four amino acids, and from the related rat sequence by five amino acids.
    Isotype
    IgG
    Top Product
    Discover our top product MMP13 Anticorps primaire
  • Indications d'application
    WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human
    Notes: Tested Species: Species with positive results.
    Other applications have not been tested. Optimal dilutions should be determined by end users.
    Commentaires

    Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

    Restrictions
    For Research Use only
  • Format
    Lyophilized
    Reconstitution
    Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
    Concentration
    500 μg/mL
    Buffer
    Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
    Agent conservateur
    Sodium azide
    Précaution d'utilisation
    This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
    Conseil sur la manipulation
    Avoid repeated freezing and thawing.
    Stock
    4 °C/-20 °C
    Stockage commentaire
    At -20°C for one year. After reconstitution, at 4°C for one month.
    It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
  • Ma, Lv, Yu, Zhang, Kong, Niu, Yi: "Protective effects of tumor necrosis factor-α blockade by adalimumab on articular cartilage and subchondral bone in a rat model of osteoarthritis." dans: Brazilian journal of medical and biological research = Revista brasileira de pesquisas medicas e biologicas, Vol. 48, Issue 10, pp. 863-70, (2016) (PubMed).

    Liu, Tian, Zhou, Wang, Gou, Zhang, Wang, Shen, Zhang, Zhang: "Protective effect of calcitonin on lumbar fusion-induced adjacent-segment disc degeneration in ovariectomized rat." dans: BMC musculoskeletal disorders, Vol. 16, pp. 342, (2016) (PubMed).

    Xia, He, Guo, Qing, He: "Effects of ultrasound on estradiol level, bone mineral density, bone biomechanics and matrix metalloproteinase-13 expression in ovariectomized rabbits." dans: Experimental and therapeutic medicine, Vol. 10, Issue 4, pp. 1429-1436, (2015) (PubMed).

    Huang, Zou, Shi, Zhang, Pen, Zhang, Gao, Wang: "The effect of electroacupuncture on the extracellular matrix synthesis and degradation in a rabbit model of disc degeneration." dans: Evidence-based complementary and alternative medicine : eCAM, Vol. 2014, pp. 731395, (2014) (PubMed).

  • Antigène
    MMP13 (Matrix Metallopeptidase 13 (Collagenase 3) (MMP13))
    Autre désignation
    MMP13 (MMP13 Produits)
    Synonymes
    anticorps CLG3, anticorps MANDP1, anticorps Clg, anticorps MMP-13, anticorps Mmp1, anticorps cb1034, anticorps mmp13, anticorps gene A, anticorps xCol, anticorps xcl3, anticorps MMP13, anticorps MGC108008, anticorps matrix metallopeptidase 13, anticorps matrix metallopeptidase 13a, anticorps matrix metallopeptidase 13 (collagenase 3) like S homeolog, anticorps matrix metallopeptidase 13 (collagenase 3), anticorps matrix metalloproteinase 13, anticorps matrix metallopeptidase 13 (collagenase 3) like L homeolog, anticorps MMP13, anticorps Mmp13, anticorps mmp13a, anticorps mmp13l.S, anticorps mmp13, anticorps LOC100136348, anticorps mmp13l.L
    Sujet
    Collagenase 3 is an enzyme that in humans is encoded by the MMP13 gene. This gene encodes a member of the peptidase M10 family of matrix metalloproteinases (MMPs). Proteins in this family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis. The encoded preproprotein is proteolytically processed to generate the mature protease. This protease cleaves type II collagen more efficiently than types I and III. It may be involved in articular cartilage turnover and cartilage pathophysiology associated with osteoarthritis. Mutations in this gene are associated with metaphyseal anadysplasia. This gene is part of a cluster of MMP genes on chromosome 11.

    Synonyms: CLG 3 | CLG3 | Collagenase 3 | Collagenase3 | MANDP1 | MDST | MMP13 | MMP-13 | MMP 13 | P45452
    ID gène
    4322
    UniProt
    P45452
Vous êtes ici:
Support technique