MMP13 anticorps (N-Term)
-
- Antigène Voir toutes MMP13 Anticorps
- MMP13 (Matrix Metallopeptidase 13 (Collagenase 3) (MMP13))
-
Épitope
- AA 109-154, N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp MMP13 est non-conjugé
-
Application
- Western Blotting (WB)
- Fonction
- Rabbit IgG polyclonal antibody for Collagenase 3 (MMP13) detection. Tested with WB in Human.
- Séquence
- RTLKWSKMNL TYRIVNYTPD MTHSEVEKAF KKAFKVWSDV TPLNFT
- Réactivité croisée (Details)
- No cross reactivity with other proteins.
- Attributs du produit
-
Rabbit IgG polyclonal antibody for Collagenase 3 (MMP13) detection. Tested with WB in Human.
Gene Name: matrix metallopeptidase 13
Protein Name: Collagenase 3 - Purification
- Immunogen affinity purified.
- Immunogène
- A synthetic peptide corresponding to a sequence at the N-terminus of human MMP13 (109-154aa RTLKWSKMNLTYRIVNYTPDMTHSEVEKAFKKAFKVWSDVTPLNFT), different from the related mouse sequence by four amino acids, and from the related rat sequence by five amino acids.
- Isotype
- IgG
- Top Product
- Discover our top product MMP13 Anticorps primaire
-
-
- Indications d'application
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users. - Commentaires
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB.
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Concentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Agent conservateur
- Sodium azide
- Précaution d'utilisation
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Conseil sur la manipulation
- Avoid repeated freezing and thawing.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
-
Protective effects of tumor necrosis factor-α blockade by adalimumab on articular cartilage and subchondral bone in a rat model of osteoarthritis." dans: Brazilian journal of medical and biological research = Revista brasileira de pesquisas medicas e biologicas, Vol. 48, Issue 10, pp. 863-70, (2016) (PubMed).
: "Protective effect of calcitonin on lumbar fusion-induced adjacent-segment disc degeneration in ovariectomized rat." dans: BMC musculoskeletal disorders, Vol. 16, pp. 342, (2016) (PubMed).
: "Effects of ultrasound on estradiol level, bone mineral density, bone biomechanics and matrix metalloproteinase-13 expression in ovariectomized rabbits." dans: Experimental and therapeutic medicine, Vol. 10, Issue 4, pp. 1429-1436, (2015) (PubMed).
: "The effect of electroacupuncture on the extracellular matrix synthesis and degradation in a rabbit model of disc degeneration." dans: Evidence-based complementary and alternative medicine : eCAM, Vol. 2014, pp. 731395, (2014) (PubMed).
: "
-
Protective effects of tumor necrosis factor-α blockade by adalimumab on articular cartilage and subchondral bone in a rat model of osteoarthritis." dans: Brazilian journal of medical and biological research = Revista brasileira de pesquisas medicas e biologicas, Vol. 48, Issue 10, pp. 863-70, (2016) (PubMed).
-
- Antigène
- MMP13 (Matrix Metallopeptidase 13 (Collagenase 3) (MMP13))
- Autre désignation
- MMP13 (MMP13 Produits)
- Synonymes
- anticorps CLG3, anticorps MANDP1, anticorps Clg, anticorps MMP-13, anticorps Mmp1, anticorps cb1034, anticorps mmp13, anticorps gene A, anticorps xCol, anticorps xcl3, anticorps MMP13, anticorps MGC108008, anticorps matrix metallopeptidase 13, anticorps matrix metallopeptidase 13a, anticorps matrix metallopeptidase 13 (collagenase 3) like S homeolog, anticorps matrix metallopeptidase 13 (collagenase 3), anticorps matrix metalloproteinase 13, anticorps matrix metallopeptidase 13 (collagenase 3) like L homeolog, anticorps MMP13, anticorps Mmp13, anticorps mmp13a, anticorps mmp13l.S, anticorps mmp13, anticorps LOC100136348, anticorps mmp13l.L
- Sujet
-
Collagenase 3 is an enzyme that in humans is encoded by the MMP13 gene. This gene encodes a member of the peptidase M10 family of matrix metalloproteinases (MMPs). Proteins in this family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis. The encoded preproprotein is proteolytically processed to generate the mature protease. This protease cleaves type II collagen more efficiently than types I and III. It may be involved in articular cartilage turnover and cartilage pathophysiology associated with osteoarthritis. Mutations in this gene are associated with metaphyseal anadysplasia. This gene is part of a cluster of MMP genes on chromosome 11.
Synonyms: CLG 3 | CLG3 | Collagenase 3 | Collagenase3 | MANDP1 | MDST | MMP13 | MMP-13 | MMP 13 | P45452 - ID gène
- 4322
- UniProt
- P45452
-