MPP1 anticorps (C-Term)
-
- Antigène Voir toutes MPP1 Anticorps
- MPP1 (Membrane Protein, Palmitoylated 1, 55kDa (MPP1))
-
Épitope
- AA 409-450, C-Term
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp MPP1 est non-conjugé
-
Application
- Western Blotting (WB)
- Fonction
- Rabbit IgG polyclonal antibody for 55 kDa erythrocyte membrane protein(MPP1) detection. Tested with WB in Human,Mouse,Rat.
- Séquence
- TEALQQLQKD SEAIRSQYAH YFDLSLVNNG VDETLKKLQE AF
- Réactivité croisée (Details)
- No cross reactivity with other proteins.
- Attributs du produit
-
Rabbit IgG polyclonal antibody for 55 kDa erythrocyte membrane protein(MPP1) detection. Tested with WB in Human,Mouse,Rat.
Gene Name: membrane palmitoylated protein 1
Protein Name: 55 kDa erythrocyte membrane protein - Purification
- Immunogen affinity purified.
- Immunogène
- A synthetic peptide corresponding to a sequence at the C-terminus of human MPP1 (409-450aa TEALQQLQKDSEAIRSQYAHYFDLSLVNNGVDETLKKLQEAF), different from the related mouse sequence by one amino acid.
- Isotype
- IgG
- Top Product
- Discover our top product MPP1 Anticorps primaire
-
-
- Indications d'application
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users. - Commentaires
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB.
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Concentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Agent conservateur
- Sodium azide
- Précaution d'utilisation
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Conseil sur la manipulation
- Avoid repeated freezing and thawing.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Antigène
- MPP1 (Membrane Protein, Palmitoylated 1, 55kDa (MPP1))
- Autre désignation
- MPP1 (MPP1 Produits)
- Synonymes
- anticorps AAG12, anticorps DXS552E, anticorps EMP55, anticorps MRG1, anticorps PEMP, anticorps MGC53500, anticorps MGC89895, anticorps MPP1, anticorps p55, anticorps cb997, anticorps zgc:77039, anticorps wu:fc85f03, anticorps 55kDa, anticorps C130070C03Rik, anticorps membrane palmitoylated protein 1, anticorps membrane protein, palmitoylated 1 L homeolog, anticorps membrane protein, palmitoylated 1, anticorps membrane protein, palmitoylated, anticorps MPP1, anticorps mpp1.L, anticorps mpp1, anticorps Mpp1
- Sujet
-
55 kDa erythrocyte membrane protein is a protein that in humans is encoded by the MPP1 gene. This gene encodes the prototype of the membrane-associated guanylate kinase (MAGUK) family proteins. MAGUKs interact with the cytoskeleton and regulate cell proliferation, signaling pathways, and intercellular junctions. The encoded protein is an extensively palmitoylated membrane phosphoprotein containing a PDZ domain, a Src homology 3 (SH3) motif, and a guanylate kinase domain. This gene product interacts with various cytoskeletal proteins and cell junctional proteins in different tissue and cell types, and may be involved in the regulation of cell shape, hair cell development, neural patterning of the retina, and apico-basal polarity and tumor suppression pathways in non-erythroid cells. Multiple transcript variants encoding different isoforms have been found for this gene.
Synonyms: AAG 12 | AAG12 | DXS552 | DXS552E | EMP 55 | EMP55 | MPP 1 | MPP1 | MRG 1 | MRG1 | p55 | palmitoylated 1 | PEMP | Q00013 - ID gène
- 4354
- UniProt
- Q00013
-