NEDD8 anticorps (Middle Region)
-
- Antigène Voir toutes NEDD8 Anticorps
- NEDD8 (Neural Precursor Cell Expressed, Developmentally Down-Regulated 8 (NEDD8))
-
Épitope
- AA 20-60, Middle Region
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp NEDD8 est non-conjugé
-
Application
- Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
- Fonction
- Rabbit IgG polyclonal antibody for NEDD8(NEDD8) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
- Séquence
- TDKVERIKER VEEKEGIPPQ QQRLIYSGKQ MNDEKTAADY K
- Réactivité croisée (Details)
- No cross reactivity with other proteins.
- Attributs du produit
-
Rabbit IgG polyclonal antibody for NEDD8(NEDD8) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: neural precursor cell expressed, developmentally down-regulated 8
Protein Name: NEDD8 - Purification
- Immunogen affinity purified.
- Immunogène
- A synthetic peptide corresponding to a sequence in the middle region of human NEDD8 (20-60aa TDKVERIKERVEEKEGIPPQQQRLIYSGKQMNDEKTAADYK), identical to the related mouse and rat sequences.
- Isotype
- IgG
- Top Product
- Discover our top product NEDD8 Anticorps primaire
-
-
- Indications d'application
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users. - Commentaires
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Concentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Agent conservateur
- Sodium azide
- Précaution d'utilisation
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Conseil sur la manipulation
- Avoid repeated freezing and thawing.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Antigène
- NEDD8 (Neural Precursor Cell Expressed, Developmentally Down-Regulated 8 (NEDD8))
- Autre désignation
- NEDD8 (NEDD8 Produits)
- Synonymes
- anticorps NEDD-8, anticorps Rub1, anticorps CG10679, anticorps Dmel\\CG10679, anticorps NEDD8, anticorps dNEDD8, anticorps nedd8, anticorps ubiquitin, anticorps si:zc14a17.5, anticorps GB17785, anticorps DDBDRAFT_0218116, anticorps DDBDRAFT_0238041, anticorps DDB_0218116, anticorps DDB_0238041, anticorps nedd8.S, anticorps neural precursor cell expressed, developmentally down-regulated 8, anticorps neural precursor cell expressed, developmentally down-regulated gene 8, anticorps CG10679 gene product from transcript CG10679-RB, anticorps Nedd8, anticorps ubiquitin-like protein Nedd8, anticorps neural precursor cell expressed, developmentally down-regulated 8 L homeolog, anticorps NEDD8, anticorps Nedd8, anticorps nedd8, anticorps nedd8.L
- Sujet
-
NEDD8 is a protein that in humans is encoded by the NEDD8 gene. Human NEDD8 shares 60 % amino acid sequence identity to ubiquitin. The most substrates of NEDD8 modification are the Cullin subunits of Cullin-based E3 ubiquitin ligases, which are active only when neddylated. Their NEDDylation is critical for the recruitment of E2 to the ligase complex, thus facilitating ubiquitin conjugation. NEDD8 modification has therefore been implicated in cell cycle progression and cytoskeletal regulation.
Synonyms: NED8 | NEDD 8 | NEDD-8 | Nedd8 | Neddylin | Rub1 | Q15843 - ID gène
- 4738
- UniProt
- Q15843
- Pathways
- Ubiquitin Proteasome Pathway
-